芝麻web文件管理V1.00
编辑当前文件:/home/conskgoa/doughi.co.uk/dns.zip
PK g\ grange.pynu [ # Copyright (C) 2003-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. """DNS GENERATE range conversion.""" import dns def from_text(text): """Convert the text form of a range in a GENERATE statement to an integer. @param text: the textual range @type text: string @return: The start, stop and step values. @rtype: tuple """ # TODO, figure out the bounds on start, stop and step. step = 1 cur = '' state = 0 # state 0 1 2 3 4 # x - y / z if text and text[0] == '-': raise dns.exception.SyntaxError("Start cannot be a negative number") for c in text: if c == '-' and state == 0: start = int(cur) cur = '' state = 2 elif c == '/': stop = int(cur) cur = '' state = 4 elif c.isdigit(): cur += c else: raise dns.exception.SyntaxError("Could not parse %s" % (c)) if state in (1, 3): raise dns.exception.SyntaxError() if state == 2: stop = int(cur) if state == 4: step = int(cur) assert step >= 1 assert start >= 0 assert start <= stop # TODO, can start == stop? return (start, stop, step) PK g\`o L L hash.pynu [ # Copyright (C) 2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. """Hashing backwards compatibility wrapper""" import hashlib hashes = {} hashes['MD5'] = hashlib.md5 hashes['SHA1'] = hashlib.sha1 hashes['SHA224'] = hashlib.sha224 hashes['SHA256'] = hashlib.sha256 hashes['SHA384'] = hashlib.sha384 hashes['SHA512'] = hashlib.sha512 def get(algorithm): return hashes[algorithm.upper()] PK g\2Y9 inet.pynu [ # Copyright (C) 2003-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. """Generic Internet address helper functions.""" import socket import dns.ipv4 import dns.ipv6 # We assume that AF_INET is always defined. AF_INET = socket.AF_INET # AF_INET6 might not be defined in the socket module, but we need it. # We'll try to use the socket module's value, and if it doesn't work, # we'll use our own value. try: AF_INET6 = socket.AF_INET6 except AttributeError: AF_INET6 = 9999 def inet_pton(family, text): """Convert the textual form of a network address into its binary form. @param family: the address family @type family: int @param text: the textual address @type text: string @raises NotImplementedError: the address family specified is not implemented. @rtype: string """ if family == AF_INET: return dns.ipv4.inet_aton(text) elif family == AF_INET6: return dns.ipv6.inet_aton(text) else: raise NotImplementedError def inet_ntop(family, address): """Convert the binary form of a network address into its textual form. @param family: the address family @type family: int @param address: the binary address @type address: string @raises NotImplementedError: the address family specified is not implemented. @rtype: string """ if family == AF_INET: return dns.ipv4.inet_ntoa(address) elif family == AF_INET6: return dns.ipv6.inet_ntoa(address) else: raise NotImplementedError def af_for_address(text): """Determine the address family of a textual-form network address. @param text: the textual address @type text: string @raises ValueError: the address family cannot be determined from the input. @rtype: int """ try: dns.ipv4.inet_aton(text) return AF_INET except Exception: try: dns.ipv6.inet_aton(text) return AF_INET6 except: raise ValueError def is_multicast(text): """Is the textual-form network address a multicast address? @param text: the textual address @raises ValueError: the address family cannot be determined from the input. @rtype: bool """ try: first = ord(dns.ipv4.inet_aton(text)[0]) return first >= 224 and first <= 239 except Exception: try: first = ord(dns.ipv6.inet_aton(text)[0]) return first == 255 except Exception: raise ValueError PK g\E!o& & tsig.pynu [ # Copyright (C) 2001-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. """DNS TSIG support.""" import hmac import struct import dns.exception import dns.hash import dns.rdataclass import dns.name from ._compat import long, string_types, text_type class BadTime(dns.exception.DNSException): """The current time is not within the TSIG's validity time.""" class BadSignature(dns.exception.DNSException): """The TSIG signature fails to verify.""" class PeerError(dns.exception.DNSException): """Base class for all TSIG errors generated by the remote peer""" class PeerBadKey(PeerError): """The peer didn't know the key we used""" class PeerBadSignature(PeerError): """The peer didn't like the signature we sent""" class PeerBadTime(PeerError): """The peer didn't like the time we sent""" class PeerBadTruncation(PeerError): """The peer didn't like amount of truncation in the TSIG we sent""" # TSIG Algorithms HMAC_MD5 = dns.name.from_text("HMAC-MD5.SIG-ALG.REG.INT") HMAC_SHA1 = dns.name.from_text("hmac-sha1") HMAC_SHA224 = dns.name.from_text("hmac-sha224") HMAC_SHA256 = dns.name.from_text("hmac-sha256") HMAC_SHA384 = dns.name.from_text("hmac-sha384") HMAC_SHA512 = dns.name.from_text("hmac-sha512") _hashes = { HMAC_SHA224: 'SHA224', HMAC_SHA256: 'SHA256', HMAC_SHA384: 'SHA384', HMAC_SHA512: 'SHA512', HMAC_SHA1: 'SHA1', HMAC_MD5: 'MD5', } default_algorithm = HMAC_MD5 BADSIG = 16 BADKEY = 17 BADTIME = 18 BADTRUNC = 22 def sign(wire, keyname, secret, time, fudge, original_id, error, other_data, request_mac, ctx=None, multi=False, first=True, algorithm=default_algorithm): """Return a (tsig_rdata, mac, ctx) tuple containing the HMAC TSIG rdata for the input parameters, the HMAC MAC calculated by applying the TSIG signature algorithm, and the TSIG digest context. @rtype: (string, string, hmac.HMAC object) @raises ValueError: I{other_data} is too long @raises NotImplementedError: I{algorithm} is not supported """ if isinstance(other_data, text_type): other_data = other_data.encode() (algorithm_name, digestmod) = get_algorithm(algorithm) if first: ctx = hmac.new(secret, digestmod=digestmod) ml = len(request_mac) if ml > 0: ctx.update(struct.pack('!H', ml)) ctx.update(request_mac) id = struct.pack('!H', original_id) ctx.update(id) ctx.update(wire[2:]) if first: ctx.update(keyname.to_digestable()) ctx.update(struct.pack('!H', dns.rdataclass.ANY)) ctx.update(struct.pack('!I', 0)) long_time = time + long(0) upper_time = (long_time >> 32) & long(0xffff) lower_time = long_time & long(0xffffffff) time_mac = struct.pack('!HIH', upper_time, lower_time, fudge) pre_mac = algorithm_name + time_mac ol = len(other_data) if ol > 65535: raise ValueError('TSIG Other Data is > 65535 bytes') post_mac = struct.pack('!HH', error, ol) + other_data if first: ctx.update(pre_mac) ctx.update(post_mac) else: ctx.update(time_mac) mac = ctx.digest() mpack = struct.pack('!H', len(mac)) tsig_rdata = pre_mac + mpack + mac + id + post_mac if multi: ctx = hmac.new(secret, digestmod=digestmod) ml = len(mac) ctx.update(struct.pack('!H', ml)) ctx.update(mac) else: ctx = None return (tsig_rdata, mac, ctx) def hmac_md5(wire, keyname, secret, time, fudge, original_id, error, other_data, request_mac, ctx=None, multi=False, first=True, algorithm=default_algorithm): return sign(wire, keyname, secret, time, fudge, original_id, error, other_data, request_mac, ctx, multi, first, algorithm) def validate(wire, keyname, secret, now, request_mac, tsig_start, tsig_rdata, tsig_rdlen, ctx=None, multi=False, first=True): """Validate the specified TSIG rdata against the other input parameters. @raises FormError: The TSIG is badly formed. @raises BadTime: There is too much time skew between the client and the server. @raises BadSignature: The TSIG signature did not validate @rtype: hmac.HMAC object""" (adcount,) = struct.unpack("!H", wire[10:12]) if adcount == 0: raise dns.exception.FormError adcount -= 1 new_wire = wire[0:10] + struct.pack("!H", adcount) + wire[12:tsig_start] current = tsig_rdata (aname, used) = dns.name.from_wire(wire, current) current = current + used (upper_time, lower_time, fudge, mac_size) = \ struct.unpack("!HIHH", wire[current:current + 10]) time = ((upper_time + long(0)) << 32) + (lower_time + long(0)) current += 10 mac = wire[current:current + mac_size] current += mac_size (original_id, error, other_size) = \ struct.unpack("!HHH", wire[current:current + 6]) current += 6 other_data = wire[current:current + other_size] current += other_size if current != tsig_rdata + tsig_rdlen: raise dns.exception.FormError if error != 0: if error == BADSIG: raise PeerBadSignature elif error == BADKEY: raise PeerBadKey elif error == BADTIME: raise PeerBadTime elif error == BADTRUNC: raise PeerBadTruncation else: raise PeerError('unknown TSIG error code %d' % error) time_low = time - fudge time_high = time + fudge if now < time_low or now > time_high: raise BadTime (junk, our_mac, ctx) = sign(new_wire, keyname, secret, time, fudge, original_id, error, other_data, request_mac, ctx, multi, first, aname) if our_mac != mac: raise BadSignature return ctx def get_algorithm(algorithm): """Returns the wire format string and the hash module to use for the specified TSIG algorithm @rtype: (string, hash constructor) @raises NotImplementedError: I{algorithm} is not supported """ if isinstance(algorithm, string_types): algorithm = dns.name.from_text(algorithm) try: return (algorithm.to_digestable(), dns.hash.hashes[_hashes[algorithm]]) except KeyError: raise NotImplementedError("TSIG algorithm " + str(algorithm) + " is not supported") def get_algorithm_and_mac(wire, tsig_rdata, tsig_rdlen): """Return the tsig algorithm for the specified tsig_rdata @raises FormError: The TSIG is badly formed. """ current = tsig_rdata (aname, used) = dns.name.from_wire(wire, current) current = current + used (upper_time, lower_time, fudge, mac_size) = \ struct.unpack("!HIHH", wire[current:current + 10]) current += 10 mac = wire[current:current + mac_size] current += mac_size if current > tsig_rdata + tsig_rdlen: raise dns.exception.FormError return (aname, mac) PK g\ӉG G tokenizer.pynu [ # Copyright (C) 2003-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. """Tokenize DNS master file format""" from io import StringIO import sys import dns.exception import dns.name import dns.ttl from ._compat import long, text_type, binary_type _DELIMITERS = { ' ': True, '\t': True, '\n': True, ';': True, '(': True, ')': True, '"': True} _QUOTING_DELIMITERS = {'"': True} EOF = 0 EOL = 1 WHITESPACE = 2 IDENTIFIER = 3 QUOTED_STRING = 4 COMMENT = 5 DELIMITER = 6 class UngetBufferFull(dns.exception.DNSException): """An attempt was made to unget a token when the unget buffer was full.""" class Token(object): """A DNS master file format token. @ivar ttype: The token type @type ttype: int @ivar value: The token value @type value: string @ivar has_escape: Does the token value contain escapes? @type has_escape: bool """ def __init__(self, ttype, value='', has_escape=False): """Initialize a token instance. @param ttype: The token type @type ttype: int @param value: The token value @type value: string @param has_escape: Does the token value contain escapes? @type has_escape: bool """ self.ttype = ttype self.value = value self.has_escape = has_escape def is_eof(self): return self.ttype == EOF def is_eol(self): return self.ttype == EOL def is_whitespace(self): return self.ttype == WHITESPACE def is_identifier(self): return self.ttype == IDENTIFIER def is_quoted_string(self): return self.ttype == QUOTED_STRING def is_comment(self): return self.ttype == COMMENT def is_delimiter(self): return self.ttype == DELIMITER def is_eol_or_eof(self): return self.ttype == EOL or self.ttype == EOF def __eq__(self, other): if not isinstance(other, Token): return False return (self.ttype == other.ttype and self.value == other.value) def __ne__(self, other): if not isinstance(other, Token): return True return (self.ttype != other.ttype or self.value != other.value) def __str__(self): return '%d "%s"' % (self.ttype, self.value) def unescape(self): if not self.has_escape: return self unescaped = '' l = len(self.value) i = 0 while i < l: c = self.value[i] i += 1 if c == '\\': if i >= l: raise dns.exception.UnexpectedEnd c = self.value[i] i += 1 if c.isdigit(): if i >= l: raise dns.exception.UnexpectedEnd c2 = self.value[i] i += 1 if i >= l: raise dns.exception.UnexpectedEnd c3 = self.value[i] i += 1 if not (c2.isdigit() and c3.isdigit()): raise dns.exception.SyntaxError c = chr(int(c) * 100 + int(c2) * 10 + int(c3)) unescaped += c return Token(self.ttype, unescaped) # compatibility for old-style tuple tokens def __len__(self): return 2 def __iter__(self): return iter((self.ttype, self.value)) def __getitem__(self, i): if i == 0: return self.ttype elif i == 1: return self.value else: raise IndexError class Tokenizer(object): """A DNS master file format tokenizer. A token is a (type, value) tuple, where I{type} is an int, and I{value} is a string. The valid types are EOF, EOL, WHITESPACE, IDENTIFIER, QUOTED_STRING, COMMENT, and DELIMITER. @ivar file: The file to tokenize @type file: file @ivar ungotten_char: The most recently ungotten character, or None. @type ungotten_char: string @ivar ungotten_token: The most recently ungotten token, or None. @type ungotten_token: (int, string) token tuple @ivar multiline: The current multiline level. This value is increased by one every time a '(' delimiter is read, and decreased by one every time a ')' delimiter is read. @type multiline: int @ivar quoting: This variable is true if the tokenizer is currently reading a quoted string. @type quoting: bool @ivar eof: This variable is true if the tokenizer has encountered EOF. @type eof: bool @ivar delimiters: The current delimiter dictionary. @type delimiters: dict @ivar line_number: The current line number @type line_number: int @ivar filename: A filename that will be returned by the L{where} method. @type filename: string """ def __init__(self, f=sys.stdin, filename=None): """Initialize a tokenizer instance. @param f: The file to tokenize. The default is sys.stdin. This parameter may also be a string, in which case the tokenizer will take its input from the contents of the string. @type f: file or string @param filename: the name of the filename that the L{where} method will return. @type filename: string """ if isinstance(f, text_type): f = StringIO(f) if filename is None: filename = '<string>' elif isinstance(f, binary_type): f = StringIO(f.decode()) if filename is None: filename = '<string>' else: if filename is None: if f is sys.stdin: filename = '<stdin>' else: filename = '<file>' self.file = f self.ungotten_char = None self.ungotten_token = None self.multiline = 0 self.quoting = False self.eof = False self.delimiters = _DELIMITERS self.line_number = 1 self.filename = filename def _get_char(self): """Read a character from input. @rtype: string """ if self.ungotten_char is None: if self.eof: c = '' else: c = self.file.read(1) if c == '': self.eof = True elif c == '\n': self.line_number += 1 else: c = self.ungotten_char self.ungotten_char = None return c def where(self): """Return the current location in the input. @rtype: (string, int) tuple. The first item is the filename of the input, the second is the current line number. """ return (self.filename, self.line_number) def _unget_char(self, c): """Unget a character. The unget buffer for characters is only one character large; it is an error to try to unget a character when the unget buffer is not empty. @param c: the character to unget @type c: string @raises UngetBufferFull: there is already an ungotten char """ if self.ungotten_char is not None: raise UngetBufferFull self.ungotten_char = c def skip_whitespace(self): """Consume input until a non-whitespace character is encountered. The non-whitespace character is then ungotten, and the number of whitespace characters consumed is returned. If the tokenizer is in multiline mode, then newlines are whitespace. @rtype: int """ skipped = 0 while True: c = self._get_char() if c != ' ' and c != '\t': if (c != '\n') or not self.multiline: self._unget_char(c) return skipped skipped += 1 def get(self, want_leading=False, want_comment=False): """Get the next token. @param want_leading: If True, return a WHITESPACE token if the first character read is whitespace. The default is False. @type want_leading: bool @param want_comment: If True, return a COMMENT token if the first token read is a comment. The default is False. @type want_comment: bool @rtype: Token object @raises dns.exception.UnexpectedEnd: input ended prematurely @raises dns.exception.SyntaxError: input was badly formed """ if self.ungotten_token is not None: token = self.ungotten_token self.ungotten_token = None if token.is_whitespace(): if want_leading: return token elif token.is_comment(): if want_comment: return token else: return token skipped = self.skip_whitespace() if want_leading and skipped > 0: return Token(WHITESPACE, ' ') token = '' ttype = IDENTIFIER has_escape = False while True: c = self._get_char() if c == '' or c in self.delimiters: if c == '' and self.quoting: raise dns.exception.UnexpectedEnd if token == '' and ttype != QUOTED_STRING: if c == '(': self.multiline += 1 self.skip_whitespace() continue elif c == ')': if self.multiline <= 0: raise dns.exception.SyntaxError self.multiline -= 1 self.skip_whitespace() continue elif c == '"': if not self.quoting: self.quoting = True self.delimiters = _QUOTING_DELIMITERS ttype = QUOTED_STRING continue else: self.quoting = False self.delimiters = _DELIMITERS self.skip_whitespace() continue elif c == '\n': return Token(EOL, '\n') elif c == ';': while 1: c = self._get_char() if c == '\n' or c == '': break token += c if want_comment: self._unget_char(c) return Token(COMMENT, token) elif c == '': if self.multiline: raise dns.exception.SyntaxError( 'unbalanced parentheses') return Token(EOF) elif self.multiline: self.skip_whitespace() token = '' continue else: return Token(EOL, '\n') else: # This code exists in case we ever want a # delimiter to be returned. It never produces # a token currently. token = c ttype = DELIMITER else: self._unget_char(c) break elif self.quoting: if c == '\\': c = self._get_char() if c == '': raise dns.exception.UnexpectedEnd if c.isdigit(): c2 = self._get_char() if c2 == '': raise dns.exception.UnexpectedEnd c3 = self._get_char() if c == '': raise dns.exception.UnexpectedEnd if not (c2.isdigit() and c3.isdigit()): raise dns.exception.SyntaxError c = chr(int(c) * 100 + int(c2) * 10 + int(c3)) elif c == '\n': raise dns.exception.SyntaxError('newline in quoted string') elif c == '\\': # # It's an escape. Put it and the next character into # the token; it will be checked later for goodness. # token += c has_escape = True c = self._get_char() if c == '' or c == '\n': raise dns.exception.UnexpectedEnd token += c if token == '' and ttype != QUOTED_STRING: if self.multiline: raise dns.exception.SyntaxError('unbalanced parentheses') ttype = EOF return Token(ttype, token, has_escape) def unget(self, token): """Unget a token. The unget buffer for tokens is only one token large; it is an error to try to unget a token when the unget buffer is not empty. @param token: the token to unget @type token: Token object @raises UngetBufferFull: there is already an ungotten token """ if self.ungotten_token is not None: raise UngetBufferFull self.ungotten_token = token def next(self): """Return the next item in an iteration. @rtype: (int, string) """ token = self.get() if token.is_eof(): raise StopIteration return token __next__ = next def __iter__(self): return self # Helpers def get_int(self): """Read the next token and interpret it as an integer. @raises dns.exception.SyntaxError: @rtype: int """ token = self.get().unescape() if not token.is_identifier(): raise dns.exception.SyntaxError('expecting an identifier') if not token.value.isdigit(): raise dns.exception.SyntaxError('expecting an integer') return int(token.value) def get_uint8(self): """Read the next token and interpret it as an 8-bit unsigned integer. @raises dns.exception.SyntaxError: @rtype: int """ value = self.get_int() if value < 0 or value > 255: raise dns.exception.SyntaxError( '%d is not an unsigned 8-bit integer' % value) return value def get_uint16(self): """Read the next token and interpret it as a 16-bit unsigned integer. @raises dns.exception.SyntaxError: @rtype: int """ value = self.get_int() if value < 0 or value > 65535: raise dns.exception.SyntaxError( '%d is not an unsigned 16-bit integer' % value) return value def get_uint32(self): """Read the next token and interpret it as a 32-bit unsigned integer. @raises dns.exception.SyntaxError: @rtype: int """ token = self.get().unescape() if not token.is_identifier(): raise dns.exception.SyntaxError('expecting an identifier') if not token.value.isdigit(): raise dns.exception.SyntaxError('expecting an integer') value = long(token.value) if value < 0 or value > long(4294967296): raise dns.exception.SyntaxError( '%d is not an unsigned 32-bit integer' % value) return value def get_string(self, origin=None): """Read the next token and interpret it as a string. @raises dns.exception.SyntaxError: @rtype: string """ token = self.get().unescape() if not (token.is_identifier() or token.is_quoted_string()): raise dns.exception.SyntaxError('expecting a string') return token.value def get_identifier(self, origin=None): """Read the next token and raise an exception if it is not an identifier. @raises dns.exception.SyntaxError: @rtype: string """ token = self.get().unescape() if not token.is_identifier(): raise dns.exception.SyntaxError('expecting an identifier') return token.value def get_name(self, origin=None): """Read the next token and interpret it as a DNS name. @raises dns.exception.SyntaxError: @rtype: dns.name.Name object""" token = self.get() if not token.is_identifier(): raise dns.exception.SyntaxError('expecting an identifier') return dns.name.from_text(token.value, origin) def get_eol(self): """Read the next token and raise an exception if it isn't EOL or EOF. @raises dns.exception.SyntaxError: @rtype: string """ token = self.get() if not token.is_eol_or_eof(): raise dns.exception.SyntaxError( 'expected EOL or EOF, got %d "%s"' % (token.ttype, token.value)) return token.value def get_ttl(self): token = self.get().unescape() if not token.is_identifier(): raise dns.exception.SyntaxError('expecting an identifier') return dns.ttl.from_text(token.value) PK g\%. . renderer.pynu [ # Copyright (C) 2001-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. """Help for building DNS wire format messages""" from io import BytesIO import struct import random import time import dns.exception import dns.tsig from ._compat import long QUESTION = 0 ANSWER = 1 AUTHORITY = 2 ADDITIONAL = 3 class Renderer(object): """Helper class for building DNS wire-format messages. Most applications can use the higher-level L{dns.message.Message} class and its to_wire() method to generate wire-format messages. This class is for those applications which need finer control over the generation of messages. Typical use:: r = dns.renderer.Renderer(id=1, flags=0x80, max_size=512) r.add_question(qname, qtype, qclass) r.add_rrset(dns.renderer.ANSWER, rrset_1) r.add_rrset(dns.renderer.ANSWER, rrset_2) r.add_rrset(dns.renderer.AUTHORITY, ns_rrset) r.add_edns(0, 0, 4096) r.add_rrset(dns.renderer.ADDTIONAL, ad_rrset_1) r.add_rrset(dns.renderer.ADDTIONAL, ad_rrset_2) r.write_header() r.add_tsig(keyname, secret, 300, 1, 0, '', request_mac) wire = r.get_wire() @ivar output: where rendering is written @type output: BytesIO object @ivar id: the message id @type id: int @ivar flags: the message flags @type flags: int @ivar max_size: the maximum size of the message @type max_size: int @ivar origin: the origin to use when rendering relative names @type origin: dns.name.Name object @ivar compress: the compression table @type compress: dict @ivar section: the section currently being rendered @type section: int (dns.renderer.QUESTION, dns.renderer.ANSWER, dns.renderer.AUTHORITY, or dns.renderer.ADDITIONAL) @ivar counts: list of the number of RRs in each section @type counts: int list of length 4 @ivar mac: the MAC of the rendered message (if TSIG was used) @type mac: string """ def __init__(self, id=None, flags=0, max_size=65535, origin=None): """Initialize a new renderer. @param id: the message id @type id: int @param flags: the DNS message flags @type flags: int @param max_size: the maximum message size; the default is 65535. If rendering results in a message greater than I{max_size}, then L{dns.exception.TooBig} will be raised. @type max_size: int @param origin: the origin to use when rendering relative names @type origin: dns.name.Name or None. """ self.output = BytesIO() if id is None: self.id = random.randint(0, 65535) else: self.id = id self.flags = flags self.max_size = max_size self.origin = origin self.compress = {} self.section = QUESTION self.counts = [0, 0, 0, 0] self.output.write(b'\x00' * 12) self.mac = '' def _rollback(self, where): """Truncate the output buffer at offset I{where}, and remove any compression table entries that pointed beyond the truncation point. @param where: the offset @type where: int """ self.output.seek(where) self.output.truncate() keys_to_delete = [] for k, v in self.compress.items(): if v >= where: keys_to_delete.append(k) for k in keys_to_delete: del self.compress[k] def _set_section(self, section): """Set the renderer's current section. Sections must be rendered order: QUESTION, ANSWER, AUTHORITY, ADDITIONAL. Sections may be empty. @param section: the section @type section: int @raises dns.exception.FormError: an attempt was made to set a section value less than the current section. """ if self.section != section: if self.section > section: raise dns.exception.FormError self.section = section def add_question(self, qname, rdtype, rdclass=dns.rdataclass.IN): """Add a question to the message. @param qname: the question name @type qname: dns.name.Name @param rdtype: the question rdata type @type rdtype: int @param rdclass: the question rdata class @type rdclass: int """ self._set_section(QUESTION) before = self.output.tell() qname.to_wire(self.output, self.compress, self.origin) self.output.write(struct.pack("!HH", rdtype, rdclass)) after = self.output.tell() if after >= self.max_size: self._rollback(before) raise dns.exception.TooBig self.counts[QUESTION] += 1 def add_rrset(self, section, rrset, **kw): """Add the rrset to the specified section. Any keyword arguments are passed on to the rdataset's to_wire() routine. @param section: the section @type section: int @param rrset: the rrset @type rrset: dns.rrset.RRset object """ self._set_section(section) before = self.output.tell() n = rrset.to_wire(self.output, self.compress, self.origin, **kw) after = self.output.tell() if after >= self.max_size: self._rollback(before) raise dns.exception.TooBig self.counts[section] += n def add_rdataset(self, section, name, rdataset, **kw): """Add the rdataset to the specified section, using the specified name as the owner name. Any keyword arguments are passed on to the rdataset's to_wire() routine. @param section: the section @type section: int @param name: the owner name @type name: dns.name.Name object @param rdataset: the rdataset @type rdataset: dns.rdataset.Rdataset object """ self._set_section(section) before = self.output.tell() n = rdataset.to_wire(name, self.output, self.compress, self.origin, **kw) after = self.output.tell() if after >= self.max_size: self._rollback(before) raise dns.exception.TooBig self.counts[section] += n def add_edns(self, edns, ednsflags, payload, options=None): """Add an EDNS OPT record to the message. @param edns: The EDNS level to use. @type edns: int @param ednsflags: EDNS flag values. @type ednsflags: int @param payload: The EDNS sender's payload field, which is the maximum size of UDP datagram the sender can handle. @type payload: int @param options: The EDNS options list @type options: list of dns.edns.Option instances @see: RFC 2671 """ # make sure the EDNS version in ednsflags agrees with edns ednsflags &= long(0xFF00FFFF) ednsflags |= (edns << 16) self._set_section(ADDITIONAL) before = self.output.tell() self.output.write(struct.pack('!BHHIH', 0, dns.rdatatype.OPT, payload, ednsflags, 0)) if options is not None: lstart = self.output.tell() for opt in options: stuff = struct.pack("!HH", opt.otype, 0) self.output.write(stuff) start = self.output.tell() opt.to_wire(self.output) end = self.output.tell() assert end - start < 65536 self.output.seek(start - 2) stuff = struct.pack("!H", end - start) self.output.write(stuff) self.output.seek(0, 2) lend = self.output.tell() assert lend - lstart < 65536 self.output.seek(lstart - 2) stuff = struct.pack("!H", lend - lstart) self.output.write(stuff) self.output.seek(0, 2) after = self.output.tell() if after >= self.max_size: self._rollback(before) raise dns.exception.TooBig self.counts[ADDITIONAL] += 1 def add_tsig(self, keyname, secret, fudge, id, tsig_error, other_data, request_mac, algorithm=dns.tsig.default_algorithm): """Add a TSIG signature to the message. @param keyname: the TSIG key name @type keyname: dns.name.Name object @param secret: the secret to use @type secret: string @param fudge: TSIG time fudge @type fudge: int @param id: the message id to encode in the tsig signature @type id: int @param tsig_error: TSIG error code; default is 0. @type tsig_error: int @param other_data: TSIG other data. @type other_data: string @param request_mac: This message is a response to the request which had the specified MAC. @type request_mac: string @param algorithm: the TSIG algorithm to use @type algorithm: dns.name.Name object """ self._set_section(ADDITIONAL) before = self.output.tell() s = self.output.getvalue() (tsig_rdata, self.mac, ctx) = dns.tsig.sign(s, keyname, secret, int(time.time()), fudge, id, tsig_error, other_data, request_mac, algorithm=algorithm) keyname.to_wire(self.output, self.compress, self.origin) self.output.write(struct.pack('!HHIH', dns.rdatatype.TSIG, dns.rdataclass.ANY, 0, 0)) rdata_start = self.output.tell() self.output.write(tsig_rdata) after = self.output.tell() assert after - rdata_start < 65536 if after >= self.max_size: self._rollback(before) raise dns.exception.TooBig self.output.seek(rdata_start - 2) self.output.write(struct.pack('!H', after - rdata_start)) self.counts[ADDITIONAL] += 1 self.output.seek(10) self.output.write(struct.pack('!H', self.counts[ADDITIONAL])) self.output.seek(0, 2) def write_header(self): """Write the DNS message header. Writing the DNS message header is done after all sections have been rendered, but before the optional TSIG signature is added. """ self.output.seek(0) self.output.write(struct.pack('!HHHHHH', self.id, self.flags, self.counts[0], self.counts[1], self.counts[2], self.counts[3])) self.output.seek(0, 2) def get_wire(self): """Return the wire format message. @rtype: string """ return self.output.getvalue() PK g\EG exception.pynu [ # Copyright (C) 2003-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. """Common DNS Exceptions.""" class DNSException(Exception): """Abstract base class shared by all dnspython exceptions. It supports two basic modes of operation: a) Old/compatible mode is used if __init__ was called with empty **kwargs. In compatible mode all *args are passed to standard Python Exception class as before and all *args are printed by standard __str__ implementation. Class variable msg (or doc string if msg is None) is returned from str() if *args is empty. b) New/parametrized mode is used if __init__ was called with non-empty **kwargs. In the new mode *args has to be empty and all kwargs has to exactly match set in class variable self.supp_kwargs. All kwargs are stored inside self.kwargs and used in new __str__ implementation to construct formatted message based on self.fmt string. In the simplest case it is enough to override supp_kwargs and fmt class variables to get nice parametrized messages. """ msg = None # non-parametrized message supp_kwargs = set() # accepted parameters for _fmt_kwargs (sanity check) fmt = None # message parametrized with results from _fmt_kwargs def __init__(self, *args, **kwargs): self._check_params(*args, **kwargs) if kwargs: self.kwargs = self._check_kwargs(**kwargs) self.msg = str(self) else: self.kwargs = dict() # defined but empty for old mode exceptions if self.msg is None: # doc string is better implicit message than empty string self.msg = self.__doc__ if args: super(DNSException, self).__init__(*args) else: super(DNSException, self).__init__(self.msg) def _check_params(self, *args, **kwargs): """Old exceptions supported only args and not kwargs. For sanity we do not allow to mix old and new behavior.""" if args or kwargs: assert bool(args) != bool(kwargs), \ 'keyword arguments are mutually exclusive with positional args' def _check_kwargs(self, **kwargs): if kwargs: assert set(kwargs.keys()) == self.supp_kwargs, \ 'following set of keyword args is required: %s' % ( self.supp_kwargs) return kwargs def _fmt_kwargs(self, **kwargs): """Format kwargs before printing them. Resulting dictionary has to have keys necessary for str.format call on fmt class variable. """ fmtargs = {} for kw, data in kwargs.items(): if isinstance(data, (list, set)): # convert list of <someobj> to list of str(<someobj>) fmtargs[kw] = list(map(str, data)) if len(fmtargs[kw]) == 1: # remove list brackets [] from single-item lists fmtargs[kw] = fmtargs[kw].pop() else: fmtargs[kw] = data return fmtargs def __str__(self): if self.kwargs and self.fmt: # provide custom message constructed from keyword arguments fmtargs = self._fmt_kwargs(**self.kwargs) return self.fmt.format(**fmtargs) else: # print *args directly in the same way as old DNSException return super(DNSException, self).__str__() class FormError(DNSException): """DNS message is malformed.""" class SyntaxError(DNSException): """Text input is malformed.""" class UnexpectedEnd(SyntaxError): """Text input ended unexpectedly.""" class TooBig(DNSException): """The DNS message is too big.""" class Timeout(DNSException): """The DNS operation timed out.""" supp_kwargs = set(['timeout']) fmt = "The DNS operation timed out after {timeout} seconds" PK g\A ' __pycache__/opcode.cpython-36.opt-1.pycnu [ 3 bW @ s d Z ddlZdZdZdZdZdZeeeeedZe dd ej D Z G d d d ej j Zd d Zdd Zdd Zdd Zdd ZdS )z DNS Opcodes. N )QUERYIQUERYSTATUSNOTIFYUPDATEc c s | ]\}}||fV qd S )N ).0xyr r /usr/lib/python3.6/opcode.py <genexpr>& s r c @ s e Zd ZdZdS ) UnknownOpcodezAn DNS opcode is unknown.N)__name__ __module__ __qualname____doc__r r r r r ) s r c C sB | j r$t| }|dkr$|dkr$|S tj| j }|dkr>t|S )zConvert text into an opcode. @param text: the textual opcode @type text: string @raises UnknownOpcode: the opcode is unknown @rtype: int r N)isdigitint_by_textgetupperr )textvaluer r r from_text. s r c C s | d@ d? S )zUExtract an opcode from DNS message flags. @param flags: int @rtype: int i x r )flagsr r r from_flagsA s r! c C s | d> d@ S )z`Convert an opcode to a value suitable for ORing into DNS message flags. @rtype: int r i x r )r r r r to_flagsK s r" c C s t j| }|dkrt| }|S )zConvert an opcode to text. @param value: the opcdoe @type value: int @raises UnknownOpcode: the opcode is unknown @rtype: string N) _by_valuer str)r r r r r to_textT s r% c C s t | tkS )znTrue if the opcode in flags is UPDATE. @param flags: DNS flags @type flags: int @rtype: bool )r! r )r r r r is_updatec s r& )r Z dns.exceptionZdnsr r r r r r dictitemsr# Z exceptionZ DNSExceptionr r r! r" r% r& r r r r <module> s$ PK g\b? & __pycache__/tsigkeyring.cpython-36.pycnu [ 3 bW @ s8 d Z ddlmZmZ ddlZddlZdd Zdd ZdS )zA place to store TSIG keys. ) maybe_decode maybe_encodeNc C s< i }x2| D ]*}t jj|}tjt| | }|||< q W |S )zConvert a dictionary containing (textual DNS name, base64 secret) pairs into a binary keyring which has (dns.name.Name, binary secret) pairs. @rtype: dict)dnsname from_textbase64Z decodestringr )textringkeyringkeytextkeynamesecret r !/usr/lib/python3.6/tsigkeyring.pyr s r c C s< i }x2| D ]*}t |j }t tj| | }|||< q W |S )zConvert a dictionary containing (dns.name.Name, binary secret) pairs into a text keyring which has (textual DNS name, base64 secret) pairs. @rtype: dict)r to_textr Z encodestring)r r r r r r r r r & s r ) __doc__Z dns._compatr r r Zdns.namer r r r r r r <module> s PK g\= " __pycache__/version.cpython-36.pycnu [ 3 bW @ s d Z dZdZdZdZdZedkr0deeef Zn,edkrJdeeeef Zndeeeeef Zed> ed> B ed > B ed > B eB Zd S ) z&dnspython release version information. z%d.%d.%dz %d.%d.%dx%dz %d.%d.%d%x%d N)__doc__ZMAJORZMINORZMICROZ RELEASELEVELZSERIALversion hexversion r r /usr/lib/python3.6/version.py<module> s PK g\J,* * ! __pycache__/dnssec.cpython-36.pycnu [ 3 bW9 @ sH d Z ddlmZ ddlZddlZddlZddlZddlZddl Zddl Zddl Zddl Zddl ZddlmZ G dd dejjZG dd d ejjZdZd Zd Zd Zd ZdZdZdZdZ dZ dZ dZ dZ dZ!eeeeeeeee e e e e e!dZ"e#dd e"j$ D Z%dd Z&d d Z'd d Z(dDd d!Z)dEd"d#Z*d$d% Z+d&d' Z,d(d) Z-d*d+ Z.d,d- Z/d.d/ Z0d0d1 Z1d2d3 Z2d4d5 Z3d6d7 Z4d8d9 Z5dFd:d;Z6dGd<d=Z7d>d? Z8y(ddl9Z:ddl;Z:ddl<Z:e7Z=e6Z>d@Z?W n" e@k r e8Z=e8Z>dAZ?Y nX y8ddlAZAddlBZAddlCZAddlDZAd@ZEG dBdC dCeFZGW n e@k rB dAZEY nX dS )Hz.Common DNSSEC-related functions and constants. )BytesION ) string_typesc @ s e Zd ZdZdS )UnsupportedAlgorithmz&The DNSSEC algorithm is not supported.N)__name__ __module__ __qualname____doc__ r r /usr/lib/python3.6/dnssec.pyr ! s r c @ s e Zd ZdZdS )ValidationFailurez The DNSSEC signature is invalid.N)r r r r r r r r r & s r )RSAMD5DHDSAECCRSASHA1 DSANSEC3SHA1RSASHA1NSEC3SHA1 RSASHA256 RSASHA512INDIRECTECDSAP256SHA256ECDSAP384SHA384 PRIVATEDNS PRIVATEOIDc c s | ]\}}||fV qd S )Nr ).0xyr r r <genexpr>N s r+ c C s" t j| j }|dkr t| }|S )z:Convert text into a DNSSEC algorithm value @rtype: intN)_algorithm_by_textgetupperint)textvaluer r r algorithm_from_textQ s r2 c C s t j| }|dkrt| }|S )z;Convert a DNSSEC algorithm value to text @rtype: stringN)_algorithm_by_valuer- str)r1 r0 r r r algorithm_to_text[ s r5 c C s t }| j||d |j S )N)origin)r to_wiregetvalue)recordr6 sr r r _to_rdatae s r; c C s t | |}t|}| jtkr0|d d> |d S d}x<tt|d D ](}||d| d> |d| d 7 }qFW t|d dkr||t|d d> 7 }||d? d@ 7 }|d@ S d S ) Nr r r r r i )r; bytearray algorithmr rangelen)keyr6 rdataZtotalir r r key_idk s rF c C s |j dkr d}tjjd }n,|j dkr@d}tjjd }n td| t| trdtjj| |} |j | j j |j t || |j }tjdt||j|| }tjjtjjtjj|dt|S )NSHA1r SHA256r zunsupported algorithm "%s"z!HBBr )r. dnshashhashesr isinstancer name from_textupdateZ canonicalizer7 r; digeststructpackrF r@ rD Z from_wire rdataclassIN rdatatypeZDSrB )rM rC r@ r6 ZdsalgrJ rP Zdsrdatar r r make_ds{ s rV c C s g }| j |j}|d kr d S t|tjjrZy|jtjjtj j }W q^ t k rV d S X n|}x0|D ](}|j |j krdt ||jkrd|j| qdW |S )N)r- signerrL rI ZnodeZNodeZ find_rdatasetrS rT rU ZDNSKEYKeyErrorr@ rF Zkey_tagappend)keysrrsigZcandidate_keysr1 rdatasetrD r r r _find_candidate_keys s r] c C s | t ttttfkS )N)r r r r! r" )r@ r r r _is_rsa s r^ c C s | t tfkS )N)r r )r@ r r r _is_dsa s r_ c C s t o| ttfkS )N) _have_ecdsar$ r% )r@ r r r _is_ecdsa s ra c C s | t kS )N)r )r@ r r r _is_md5 s rb c C s | t tttfkS )N)r r r r )r@ r r r _is_sha1 s rc c C s | t tfkS )N)r! r$ )r@ r r r _is_sha256 s rd c C s | t kS )N)r% )r@ r r r _is_sha384 s re c C s | t kS )N)r" )r@ r r r _is_sha512 s rf c C s~ t | rtjjd S t| r,tjjd S t| rBtjjd S t| rXtjjd S t| rntjjd S td| d S )NZMD5rG rH ZSHA384ZSHA512z unknown hash for algorithm %u) rb rI rJ rK rc rd re rf r )r@ r r r _make_hash s rg c C s t | r ddddddddg}ndt| r6dd d dd g}nLt| rVd ddd dd ddd g }n,t| rvd ddd dd ddd g }n td| t|}t| j}dgd| | g d|d g d|g | ddg d|g }tj dt| f| S )N* H r r r + r r ` r e r zunknown algorithm %u0 r r r z!%dB) rb rc rd rf r rB rg Z digest_sizerQ rR )r@ ZoidZolenZdlenZidbytesr r r _make_algorithm_id s <rq c ) C s t |tr tjj|tjj}xt||D ]}|s<tdt | trX| d }| d }n | j}| }|dkrrt j }|j |k rtd|j |krtdt |j }t|j r`|j} tjd| dd \} | dd } | dkr tjd| dd \} | d d } | d| } | | d } t| d } tjjjtjjj| tjjj| f}tjjj|jf}n t|j rl|j} tjd| dd \}| dd } d |d }| dd }| d d } | d| }| |d } | d| }| |d } | d| }tjj jtjjj|tjjj|tjjj|tjjj|f}tjd |jdd \}}tjjj|tjjj|f}nt |j rr|j t krt j j!}d}n"|j t"krt j j#}d}ntd|j} tjjj| d| }tjjj| ||d }t j j$|j%||st&t j'j(|j)|||j*} t j+j,j-| |} t.| |}|jd| } |j|d } t j j/tjjj| tjjj| }ntd|j |j0t1||dd |j0|j2j3| |j4t|d k r|j5|j4d d } tjjd| }|j3|}!tj6d|j7|j8|j9}"t:|}#xP|#D ]H}$|j0|! |j0|" |$j3|}%tj6dt|%}&|j0|& |j0|% qW |j; }'t|j rt<|j |' }'| d t|' d }(tj6dd |( d fddgdg|( dg |' }'n(t|j st |j rntd|j |j=|'|r*dS q*W tddS )a Validate an RRset against a single signature rdata The owner name of the rrsig is assumed to be the same as the owner name of the rrset. @param rrset: The RRset to validate @type rrset: dns.rrset.RRset or (dns.name.Name, dns.rdataset.Rdataset) tuple @param rrsig: The signature rdata @type rrsig: dns.rrset.Rdata @param keys: The key dictionary. @type keys: a dictionary keyed by dns.name.Name with node or rdataset values @param origin: The origin to use for relative names @type origin: dns.name.Name or None @param now: The time to use when validating the signatures. The default is the current time. @type now: int z unknown keyr r NZexpiredz not yet validz!Bz!Hr r @ z!20s20s rp zunknown ECDSA curvezunknown algorithm %u *z!HHIr z!%dB zverify failure)>rL r rI rM rN rootr] r tupletimeZ expirationZ inceptionrg r@ r^ rC rQ unpackrB CryptoZ PublicKeyZRSAZ constructUtilnumber bytes_to_longZ signaturer_ r ra r$ ecdsaZcurvesZNIST256pr% ZNIST384pZpoint_is_valid generatorAssertionErrorZ ellipticcurveZPointcurveorderrZ Z VerifyingKeyZfrom_public_point ECKeyWrapperZ SignaturerO r; rW Z to_digestableZlabelssplitrR ZrdtypeZrdclassZ original_ttlsortedrP rq verify))rrsetr[ rZ r6 nowZ candidate_keyrrnamer\ rJ ZkeyptrZbytes_Zrsa_eZrsa_nZkeylenpubkeysigtZoctetsZdsa_qZdsa_pZdsa_gZdsa_yZdsa_rZdsa_sr key_lenr) r* ZpointZ verifying_keyrr: suffixZ rrnamebufZrrfixedZrrlistZrrZrrdataZrrlenrP Zpadlenr r r _validate_rrsig s " r c C s t |tr tjj|tjj}t | tr0| d }n| j}t |trR|d }|d }n |j}|}|j|}|j|}||krtdx6|D ].}yt | |||| dS tk r Y qX qW tddS )ah Validate an RRset @param rrset: The RRset to validate @type rrset: dns.rrset.RRset or (dns.name.Name, dns.rdataset.Rdataset) tuple @param rrsigset: The signature RRset @type rrsigset: dns.rrset.RRset or (dns.name.Name, dns.rdataset.Rdataset) tuple @param keys: The key dictionary. @type keys: a dictionary keyed by dns.name.Name with node or rdataset values @param origin: The origin to use for relative names @type origin: dns.name.Name or None @param now: The time to use when validating the signatures. The default is the current time. @type now: int r r zowner names do not matchNzno RRSIGs validated) rL r rI rM rN rx ry Zchoose_relativityr r ) r ZrrsigsetrZ r6 r r Z rrsignameZ rrsigrdatasetr[ r r r _validatex s* r c O s t dd S )Nz#DNSSEC validation requires pycrypto)NotImplementedError)argskwargsr r r _need_pycrypto s r TFc @ s e Zd Zdd Zdd ZdS )r c C s || _ || _d S )N)rC r )selfrC r r r r __init__ s zECKeyWrapper.__init__c C s t jjj|}| jjj||S )N)r| r} r~ r rC r Zverifies)r rP r Zdiglongr r r r s zECKeyWrapper.verifyN)r r r r r r r r r r s r )N)N)NN)NN)Hr ior rQ rz Z dns.exceptionrI Zdns.hashZdns.nameZdns.nodeZ dns.rdatasetZ dns.rdataZ dns.rdatatypeZdns.rdataclassZ_compatr Z exceptionZ DNSExceptionr r r r r r r r r r! r" r$ r% r# r& r' r, dictitemsr3 r2 r5 r; rF rV r] r^ r_ ra rb rc rd re rf rg rq r r r ZCrypto.PublicKey.RSAr| ZCrypto.PublicKey.DSAZCrypto.Util.numberZvalidateZvalidate_rrsigZ_have_pycrypto ImportErrorr Z ecdsa.ecdsaZecdsa.ellipticcurveZ ecdsa.keysr` objectr r r r r <module> s 0 PK g\i i __pycache__/name.cpython-36.pycnu [ 3 Ofr @ s d Z ddlmZ ddlZddlZddlZddlZyddlZdZ W n e k rX dZ Y nX ddl Z ddl Z ddlmZmZmZmZmZ y ejZW n. ek r ddejd > d d ZY nX dZdZd Zd Zd ZG d d de j j Z G dd de j j Z G dd de j j Z!G dd de j j Z"G dd de j j#Z$G dd de j j Z%G dd de j j Z&G dd d e j j#Z'G d d d e j j#Z(G d d d e j j#Z)G d!d" d"e j j#Z*G d#d$ d$e+Z,G d%d& d&e,Z-G d'd( d(e,Z.e/d)Z0d*Z1e-dZ2e-dZ3e2Z4e.ddddZ5e.ddddZ6e.ddddZ7e.ddddZ8e5Z9d+d, Z:d-d. Z;d/d0 Z<G d1d2 d2e+Z=e=d3gZ>e=g Z?e>dfd4d5Z@e>dfd6d7ZAd8d9 ZBdS ):zDNS Names. @var root: The DNS root name. @type root: dns.name.Name object @var empty: The empty DNS name. @type empty: dns.name.Name object )BytesIONTF )long binary_type text_typeunichr maybe_decode P c @ s e Zd ZdZdS ) EmptyLabelzA DNS label is empty.N)__name__ __module__ __qualname____doc__ r r /usr/lib/python3.6/name.pyr 4 s r c @ s e Zd ZdZdS ) BadEscapez8An escaped code in a text format of DNS name is invalid.N)r r r r r r r r r 9 s r c @ s e Zd ZdZdS ) BadPointerz=A DNS compression pointer points forward instead of backward.N)r r r r r r r r r > s r c @ s e Zd ZdZdS ) BadLabelTypez2The label type in DNS name wire format is unknown.N)r r r r r r r r r C s r c @ s e Zd ZdZdS )NeedAbsoluteNameOrOriginzvAn attempt was made to convert a non-absolute name to wire when there was also a non-absolute (or missing) origin.N)r r r r r r r r r H s r c @ s e Zd ZdZdS ) NameTooLongz A DNS name is > 255 octets long.N)r r r r r r r r r N s r c @ s e Zd ZdZdS ) LabelTooLongz A DNS label is > 63 octets long.N)r r r r r r r r r S s r c @ s e Zd ZdZdS )AbsoluteConcatenationz]An attempt was made to append anything other than the empty name to an absolute DNS name.N)r r r r r r r r r X s r c @ s e Zd ZdZdS )NoParentzMAn attempt was made to get the parent of the root name or the empty name.N)r r r r r r r r r ^ s r c @ s e Zd ZdZdS ) NoIDNA2008zLIDNA 2008 processing was requested but the idna module is not available.N)r r r r r r r r r c s r c @ s e Zd ZdZedgZdZdS ) IDNAExceptionz$IDNA processing raised an exception.idna_exceptionz+IDNA processing exception: {idna_exception}N)r r r r setZ supp_kwargsZfmtr r r r r i s r c @ s8 e Zd ZdZdd Zdd Zdd Zdd Zd d Zd S ) IDNACodecz.Abstract base class for IDNA encoder/decoders.c C s d S )Nr )selfr r r __init__t s zIDNACodec.__init__c C s |j jdS )Ns xn--)lower startswith)r" labelr r r is_idnaw s zIDNACodec.is_idnac C s" x |D ]}t |dkrdS qW dS )N FT)ord)r" r& cr r r is_all_asciiz s zIDNACodec.is_all_asciic C s t d S )N)NotImplementedError)r" r& r r r encode s zIDNACodec.encodec C s` | j |rPy|dd jd}W qX tk rL } zt|dW Y d d }~X qXX nt|}t|S )Nr Zpunycode)r )r' decode Exceptionr r _escapify)r" r& er r r r. s zIDNACodec.decodeN) r r r r r# r' r+ r- r. r r r r r! p s r! c s6 e Zd ZdZd fdd Zdd Z fddZ ZS ) IDNA2003CodeczIDNA 2003 encoder/decoder.Fc s t t| j || _dS )a Initialize the IDNA 2003 encoder/decoder. @param strict_decode: If True, then IDNA2003 checking is done when decoding. This can cause failures if the name was encoded with IDNA2008. The default is False. @type strict_decode: bool N)superr2 r# strict_decode)r" r4 ) __class__r r r# s zIDNA2003Codec.__init__c C s6 |dkr dS y t jj|S tk r0 tY nX d S )N ) encodingsidnaZToASCII UnicodeErrorr )r" r& r r r r- s zIDNA2003Codec.encodec sd | j stt| j|S |dkr"dS yttjj|S tk r^ } zt |dW Y d d }~X nX d S )Nr7 r6 )r ) r4 r3 r2 r. r0 r8 r9 Z ToUnicoder/ r )r" r& r1 )r5 r r r. s zIDNA2003Codec.decode)F)r r r r r# r- r. __classcell__r r )r5 r r2 s r2 c s6 e Zd ZdZd fdd Zdd Z fddZ ZS ) IDNA2008CodeczIDNA 2008 encoder/decoder.Fc s* t t| j || _|| _|| _|| _dS )a Initialize the IDNA 2008 encoder/decoder. @param uts_46: If True, apply Unicode IDNA compatibility processing as described in Unicode Technical Standard #46 (U{http://unicode.org/reports/tr46/}). This parameter is only meaningful if IDNA 2008 is in use. If False, do not apply the mapping. The default is False @type uts_46: bool @param transitional: If True, use the "transitional" mode described in Unicode Technical Standard #46. This parameter is only meaningful if IDNA 2008 is in use. The default is False. @type transitional: bool @param allow_pure_ascii: If True, then a label which consists of only ASCII characters is allowed. This is less strict than regular IDNA 2008, but is also necessary for mixed names, e.g. a name with starting with "_sip._tcp." and ending in an IDN suffixm which would otherwise be disallowed. The default is False @type allow_pure_ascii: bool @param strict_decode: If True, then IDNA2008 checking is done when decoding. This can cause failures if the name was encoded with IDNA2003. The default is False. @type strict_decode: bool N)r3 r< r# uts_46 transitionalallow_pure_asciir4 )r" r= r> r? r4 )r5 r r r# s zIDNA2008Codec.__init__c C s |dkr dS | j r&| j|r&|jdS ts.ty | jrFtj|d| j}tj |S tj k r| } zt |dW Y d d }~X nX d S )Nr6 r7 asciiF)r ) r? r+ r- have_idna_2008r r= r9 uts46_remapr> Zalabel IDNAErrorr )r" r& r1 r r r r- s zIDNA2008Codec.encodec s | j stt| j|S |dkr"dS ts*ty"| jr@tj|dd}t tj |S tj k rz } zt |dW Y d d }~X nX d S )Nr7 r6 F)r ) r4 r3 r< r. rA r r= r9 rB r0 ZulabelrC r )r" r& r1 )r5 r r r. s zIDNA2008Codec.decode)FFFF)r r r r r# r- r. r; r r )r5 r r< s r< s "().;\@$z"().;\@$c C s t | trzd}t | tr | j } xTt| D ]H}|tkrH|dt| 7 }q*|dkrf|dk rf|t|7 }q*|d| 7 }q*W |S d}xD| D ]<}|tkr|d| 7 }q|dkr|dt| 7 }q||7 }qW |S )zaEscape the characters in label which need it. @returns: the escaped string @rtype: stringr6 \ r( z\%03d ) isinstancebytesr r- bytearray_escapedchr _escaped_textr) )r& textr* r r r r0 s& r0 c C s t | }d}d}d}xH| D ]@}t |}||d 7 }|dkr>t|dk rR|dkrR|}|d7 }qW |dkrjt|dkr||d krtdS )a/ Check for empty labels in the middle of a label sequence, labels that are too long, and for too many labels. @raises NameTooLong: the name as a whole is too long @raises EmptyLabel: a label is empty (i.e. the root label) and appears in a position other than the end of the label sequencer r ? r7 N)lenr r r )labelsltotalijr& Zllr r r _validate_labels s rW c C s( t | tr| S t | tr | j S td S )N)rG r r r- ValueError)r& r r r _ensure_bytes/ s rY c sD e Zd ZdZdgZ fddZdd Zdd Zd d Zd d Z fd dZ dd Z dd Z dd Z dd Zdd Zdd Zdd Zd d Zd d Zd!d" Zd#d$ Zd%d& Zd'd( Zd)d* Zd+d, ZdLd.d/ZdMd1d2ZdNd3d4Z dOd5d6Z d7d8 Z d9d: Z d;d< Z d=d> Z!d?d@ Z"dAdB Z#dCdD Z$dEdF Z%dPdHdIZ&dJdK Z' Z(S )QNamezA DNS name. The dns.name.Name class represents a DNS name as a tuple of labels. Instances of the class are immutable. @ivar labels: The tuple of labels in the name. Each label is a string of up to 63 octets.rR c s2 dd |D }t t| jdt| t| j dS )zInitialize a domain name from a list of labels. @param labels: the labels @type labels: any iterable whose values are strings c S s g | ] }t |qS r )rY ).0xr r r <listcomp>H s z!Name.__init__.<locals>.<listcomp>rR N)r3 rZ __setattr__tuplerW rR )r" rR )r5 r r r# C s z Name.__init__c C s t dd S )Nz+object doesn't support attribute assignment) TypeError)r" namevaluer r r r^ L s zName.__setattr__c C s t | jS )N)rZ rR )r" r r r __copy__O s z Name.__copy__c C s t tj| j|S )N)rZ copydeepcopyrR )r" memor r r __deepcopy__R s zName.__deepcopy__c C s d| j iS )NrR )rR )r" r r r __getstate__U s zName.__getstate__c s$ t t| jd|d t| j d S )NrR )r3 rZ r^ rW rR )r" state)r5 r r __setstate__X s zName.__setstate__c C s t | jdko| jd dkS )zXIs the most significant label of this name the root label? @rtype: bool r r r7 rP )rQ rR )r" r r r is_absolute\ s zName.is_absolutec C s t | jdko| jd dkS )z\Is this name wild? (I.e. Is the least significant label '*'?) @rtype: bool r *)rQ rR )r" r r r is_wildc s z Name.is_wildc C sJ t d}x4| jD ]*}x$t|j D ]}||d> | 7 }q"W qW t|t S )zHReturn a case-insensitive hash of the name. @rtype: int r r )r rR rI r$ intmaxint)r" hr& r* r r r __hash__j s z Name.__hash__c C s* | j }|j }||kr0|r&tddfS tddfS t| j}t|j}|| }|dk rZ|}n|}d}d} t} x|dkr|d8 }|d8 }|d8 }| j| j } |j| j } | | k rd}| dkrt} | || fS | | krd}| dkrt} | || fS | d7 } qlW |}|dk r t} n|dkr t} nt} | || fS )a Compare two names, returning a 3-tuple (relation, order, nlabels). I{relation} describes the relation ship between the names, and is one of: dns.name.NAMERELN_NONE, dns.name.NAMERELN_SUPERDOMAIN, dns.name.NAMERELN_SUBDOMAIN, dns.name.NAMERELN_EQUAL, or dns.name.NAMERELN_COMMONANCESTOR I{order} is < 0 if self < other, > 0 if self > other, and == 0 if self == other. A relative name is always less than an absolute name. If both names have the same relativity, then the DNSSEC order relation is used to order them. I{nlabels} is the number of significant labels that the two names have in common. r r rP rP ) rk NAMERELN_NONErQ rR r$ NAMERELN_COMMONANCESTORNAMERELN_SUPERDOMAINNAMERELN_SUBDOMAINNAMERELN_EQUAL) r" otherZsabsZoabsl1l2ZldiffrS orderZnlabelsZnamerelnZlabel1Zlabel2r r r fullcompareu sN zName.fullcomparec C s( | j |\}}}|tks |tkr$dS dS )zoIs self a subdomain of other? The notion of subdomain includes equality. @rtype: bool TF)r{ ru rv )r" rw nronlr r r is_subdomain s zName.is_subdomainc C s( | j |\}}}|tks |tkr$dS dS )zqIs self a superdomain of other? The notion of subdomain includes equality. @rtype: bool TF)r{ rt rv )r" rw r| r} r~ r r r is_superdomain s zName.is_superdomainc C s t dd | jD S )zReturn a name which is equal to the current name, but is in DNSSEC canonical form. @rtype: dns.name.Name object c S s g | ] }|j qS r )r$ )r[ r\ r r r r] s z%Name.canonicalize.<locals>.<listcomp>)rZ rR )r" r r r canonicalize s zName.canonicalizec C s$ t |tr | j|d dkS dS d S )Nr r F)rG rZ r{ )r" rw r r r __eq__ s z Name.__eq__c C s$ t |tr | j|d dkS dS d S )Nr r T)rG rZ r{ )r" rw r r r __ne__ s z Name.__ne__c C s$ t |tr | j|d dk S tS d S )Nr r )rG rZ r{ NotImplemented)r" rw r r r __lt__ s z Name.__lt__c C s$ t |tr | j|d dkS tS d S )Nr r )rG rZ r{ r )r" rw r r r __le__ s z Name.__le__c C s$ t |tr | j|d dkS tS d S )Nr r )rG rZ r{ r )r" rw r r r __ge__ s z Name.__ge__c C s$ t |tr | j|d dkS tS d S )Nr r )rG rZ r{ r )r" rw r r r __gt__ s z Name.__gt__c C s d| j d S )Nz <DNS name >)__str__)r" r r r __repr__ s z Name.__repr__c C s | j dS )NF)to_text)r" r r r r s z Name.__str__Fc C sp t | jdkrtdS t | jdkr:| jd dkr:tdS |rV| j rV| jdd }n| j}djtt|}|S ) zConvert name to text format. @param omit_final_dot: If True, don't emit the final dot (denoting the root label) for absolute names. The default is False. @rtype: string r @r r7 .N.rP )rQ rR r rk joinmapr0 )r" omit_final_dotrS sr r r r s z Name.to_textNc sx t | jdkrdS t | jdkr2| jd dkr2dS |rN| j rN| jdd }n| j} dkr`t dj fdd|D S ) a Convert name to Unicode text format. IDN ACE labels are converted to Unicode. @param omit_final_dot: If True, don't emit the final dot (denoting the root label) for absolute names. The default is False. @type omit_final_dot: bool @param idna_codec: IDNA encoder/decoder. If None, the IDNA_2003_Practical encoder/decoder is used. The IDNA_2003_Practical decoder does not impose any policy, it just decodes punycode, so if you don't want checking for compliance, you can use this decoder for IDNA2008 as well. @type idna_codec: dns.name.IDNA @rtype: string r @r r7 r Nc s g | ]} j |qS r )r. )r[ r\ ) idna_codecr r r] ) s z#Name.to_unicode.<locals>.<listcomp>rP )rQ rR rk IDNA_2003_Practicalr )r" r r rS r )r r to_unicode s zName.to_unicodec C sX | j s:|dks|j r tt| j}|jt|j n| j}dd |D }dj|S )a Convert name to a format suitable for digesting in hashes. The name is canonicalized and converted to uncompressed wire format. @param origin: If the name is relative and origin is not None, then origin will be appended to it. @type origin: dns.name.Name object @raises NeedAbsoluteNameOrOrigin: All names in wire format are absolute. If self is a relative name, then an origin must be supplied; if it is missing, then this exception is raised @rtype: string Nc S s* g | ]"}t jd t| t||j qS )z!B%ds)structpackrQ r$ )r[ r\ r r r r] @ s z&Name.to_digestable.<locals>.<listcomp>r7 )rk r listrR extendr )r" originrR Zdlabelsr r r to_digestable+ s zName.to_digestablec C s. |dkrt }d}nd}| j sR|dks2|j r6tt| j}|jt|j n| j}d}x|D ]}t||d }|d7 }|dk r|j|} nd} | dk rd| } tj d| } |j | P qb|dk rt |dkr|j } | dkr| ||< t |} |j tj d | | dkrb|j | qbW |r*|j S dS ) a Convert name to wire format, possibly compressing it. @param file: the file where the name is emitted (typically a BytesIO file). If None, a string containing the wire name will be returned. @type file: file or None @param compress: The compression table. If None (the default) names will not be compressed. @type compress: dict @param origin: If the name is relative and origin is not None, then origin will be appended to it. @type origin: dns.name.Name object @raises NeedAbsoluteNameOrOrigin: All names in wire format are absolute. If self is a relative name, then an origin must be supplied; if it is missing, then this exception is raised NTFr r i z!Hi? z!B)r rk r r rR r rZ getr r writerQ tellgetvalue) r" filecompressr Z want_returnrR rU r& nposrb r rS r r r to_wireD s@ z Name.to_wirec C s t | jS )z@The length of the name (in labels). @rtype: int )rQ rR )r" r r r __len__| s z Name.__len__c C s | j | S )N)rR )r" indexr r r __getitem__ s zName.__getitem__c C s | j |S )N) concatenate)r" rw r r r __add__ s z Name.__add__c C s | j |S )N) relativize)r" rw r r r __sub__ s z Name.__sub__c C sn t | j}|dkr | tjjfS ||kr2tjj| fS |dk sB||krJtdt| d| t| | d fS )a( Split a name into a prefix and suffix at depth. @param depth: the number of labels in the suffix @type depth: int @raises ValueError: the depth was not >= 0 and <= the length of the name. @returns: the tuple (prefix, suffix) @rtype: tuple r z0depth must be >= 0 and <= the length of the nameN)rQ rR dnsra emptyrX rZ )r" depthrS r r r split s z Name.splitc C s: | j rt|dkrtt| j}|jt|j t|S )zReturn a new name which is the concatenation of self and other. @rtype: dns.name.Name object @raises AbsoluteConcatenation: self is absolute and other is not the empty name r )rk rQ r r rR r rZ )r" rw rR r r r r s zName.concatenatec C s0 |dk r(| j |r(t| dt| S | S dS )zIf self is a subdomain of origin, return a new name which is self relative to origin. Otherwise return self. @rtype: dns.name.Name object N)r rZ rQ )r" r r r r r s zName.relativizec C s | j s| j|S | S dS )zIf self is a relative name, return a new name which is the concatenation of self and origin. Otherwise return self. @rtype: dns.name.Name object N)rk r )r" r r r r derelativize s zName.derelativizeTc C s& |r |r| j |S | j|S n| S dS )a Return a name with the relativity desired by the caller. If origin is None, then self is returned. Otherwise, if relativize is true the name is relativized, and if relativize is false the name is derelativized. @rtype: dns.name.Name object N)r r )r" r r r r r choose_relativity s zName.choose_relativityc C s& | t ks| tkrtt| jdd S )zReturn the parent of the name. @rtype: dns.name.Name object @raises NoParent: the name is either the root name or the empty name, and thus has no parent. r N)rootr r rZ rR )r" r r r parent s z Name.parent)F)FN)N)NNN)NT))r r r r __slots__r# r^ rc rg rh rj rk rm rq r{ r r r r r r r r r r r r r r r r r r r r r r r r r r; r r )r5 r rZ 7 sJ = 8 rZ r7 c C s t | tstd|dkp"t |ts,tdg }d}d}d}d}|dkrLt}| dkrXd} | rz| dkrptd gS x| D ]}|r|dkr|j rt|}|d 7 }q||7 }d}n@|j st|d 9 }|t|7 }|d 7 }|d krd}|t|7 }qv|dkr"t |dkr t |j |j | d}qv|dkr:d}d}d}qv||7 }qvW |rPtt |dkrp|j |j | n |j d t |dks|d d kr|dk r|j t|j t|S )a Convert unicode text into a Name object. Labels are encoded in IDN ACE form. @param text: The text to convert into a name. @type text: Unicode string @param origin: The origin to append to non-absolute names. @type origin: dns.name.Name @param idna_codec: IDNA encoder/decoder. If None, the default IDNA 2003 encoder/decoder is used. @type idna_codec: dns.name.IDNA @rtype: dns.name.Name object z0input to from_unicode() must be a unicode stringNz origin must be a Name or Noner6 Fr r r r7 r r 。 ． ｡rD T)r r r r rP )rG r rX rZ IDNA_2003isdigitrn r r rQ r appendr- r r rR ) rM r r rR r& escapingedigitsrT r* r r r from_unicode sd &r c C s t | trt| ||S t | ts(td|dkp8t |tsBtdg }d}d}d}d}| dkrbd} | r| dkrztdgS xt| D ]}tjd |} |r|dkr| j rt | }|d 7 }n || 7 }d}nF| j st |d 9 }|t | 7 }|d 7 }|d kr^d}|tjd |7 }q| dkr>t |dkr.t |j| d}q| d krVd}d}d}q|| 7 }qW |rlt t |dkr|j| n |jd t |dks|d dkr|dk r|jt|j t|S )a} Convert text into a Name object. @param text: The text to convert into a name. @type text: string @param origin: The origin to append to non-absolute names. @type origin: dns.name.Name @param idna_codec: IDNA encoder/decoder. If None, the default IDNA 2003 encoder/decoder is used. @type idna_codec: dns.name.IDNA @rtype: dns.name.Name object z%input to from_text() must be a stringNz origin must be a Name or Noner7 Fr r r z!Br r r \TrP )rG r r r rX rZ rI r r r rn r rQ r r r r rR ) rM r r rR r& r r rT r* Zbyte_r r r from_text* sf &r c C s t | tstdtjj| } g }|}d}| | }|d7 }d}x|dkr|dk r|j| ||| j ||7 }|dkr||7 }nJ|dkr|d@ d | | }|dkr|d7 }||krt|}|d7 }nt | | }|d7 }|dkr@|d7 }q@W |jd t ||fS ) a^ Convert possibly compressed wire format into a Name. @param message: the entire DNS message @type message: string @param current: the offset of the beginning of the name from the start of the message @type current: int @raises dns.name.BadPointer: a compression pointer did not point backwards in the message @raises dns.name.BadLabelType: an invalid label type was encountered. @returns: a tuple consisting of the name that was read and the number of bytes of the wire format message which were consumed reading it @rtype: (dns.name.Name object, int) tuple z*input to from_wire() must be a byte stringr r @ rN r6 ) rG r rX r ZwiredataZ maybe_wrapr Zunwrapr r rZ )messageZcurrentrR Zbiggest_pointerZhopscountZcusedr r r from_wirep s< r )Cr ior r sysrd Zencodings.idnar8 r9 rA ImportErrorZ dns.exceptionr Z dns.wiredataZ_compatr r r r r ro AttributeErrorcalcsizerr rt ru rv rs Z exception SyntaxErrorr r Z FormErrorr r Z DNSExceptionr r r r r r r objectr! r2 r< rI rJ rL r ZIDNA_2003_Strictr ZIDNA_2008_PracticalZIDNA_2008_UTS_46ZIDNA_2008_StrictZIDNA_2008_TransitionalZ IDNA_2008r0 rW rY rZ r r r r r r r r r <module> st > * HFPK g\pJն ! __pycache__/update.cpython-36.pycnu [ 3 bW ' @ s` d Z ddlZddlZddlZddlZddlZddlZddlZddl m Z G dd dej j Z dS )zDNS Dynamic Update Support N ) string_typesc sx e Zd Zejjddejjf fdd ZdddZ dd Z dd Z d d Z d d Z dd ZdddZd fdd Z ZS )UpdateNc s t t| j | jtjjtjjO _t|t r>tj j |}|| _ t|t rZtj j |}|| _| j| j| j |tjjddd |dk r| j|||d dS )a Initialize a new DNS Update object. @param zone: The zone which is being updated. @type zone: A dns.name.Name or string @param rdclass: The class of the zone; defaults to dns.rdataclass.IN. @type rdclass: An int designating the class, or a string whose value is the name of a class. @param keyring: The TSIG keyring to use; defaults to None. @type keyring: dict @param keyname: The name of the TSIG key to use; defaults to None. The key must be defined in the keyring. If a keyring is specified but a keyname is not, then the key used will be the first key in the keyring. Note that the order of keys in a dictionary is not defined, so applications should supply a keyname when a keyring is used, unless they know the keyring contains only one key. @type keyname: dns.name.Name or string @param keyalgorithm: The TSIG algorithm to use; defaults to dns.tsig.default_algorithm. Constants for TSIG algorithms are defined in dns.tsig, and the currently implemented algorithms are HMAC_MD5, HMAC_SHA1, HMAC_SHA224, HMAC_SHA256, HMAC_SHA384, and HMAC_SHA512. @type keyalgorithm: string T)ZcreateZ force_uniqueN) algorithm)superr __init__flagsdnsZopcodeZto_flagsZUPDATE isinstancer name from_textorigin rdataclass zone_rdclass find_rrsetZquestion rdatatypeZSOAZuse_tsig)selfZzoneZrdclassZkeyringZkeynameZ keyalgorithm) __class__ /usr/lib/python3.6/update.pyr s zUpdate.__init__c C sB |dkr| j }|j }| j||| j|j||dd}|j|| dS )z&Add a single RR to the update section.NT) authoritycoversr r rdtypeadd)r r ttlrdZdeletingsectionr Zrrsetr r r _add_rrE s zUpdate._add_rrc G s: t |trtjj|d}t |d tjjrnx@|D ]8}|rF| j||j x |D ]}| j ||j ||d qLW q0W nt |}t |j d}t |d tjjr|r| j||d j x|D ]}| j ||||d qW nh|j d}t |trtjj|}|r| j|| x6|D ].} tjj| j|| | j}| j ||||d qW dS )a Add records. The first argument is the replace mode. If false, RRs are added to an existing RRset; if true, the RRset is replaced with the specified contents. The second argument is the section to add to. The third argument is always a name. The other arguments can be: - rdataset... - ttl, rdata... - ttl, rdtype, string...Nr )r )r r r r r rdatasetRdatasetdeleter r r listintpoprdataRdatar r r ) r replacer r argsrdsr r r sr r r _addO s0 z Update._addc G s | j d| j|f| dS )zAdd records. The first argument is always a name. The other arguments can be: - rdataset... - ttl, rdata... - ttl, rdtype, string...FN)r* r )r r r' r r r r w s z Update.addc G sf t |trtjj|d}t|dkrR| j| j|tjj tj j tj j tj j dd nt |d tj j rx|D ]&}x |D ]}| j|d|tjj qtW qjW nt|}t |d tjjrx|D ]}| j|d|tjj qW n|jd}t |trtj j|}t|dkr(| j| j|| j|tj j tjj dd n:x8|D ]0}tjj| j||| j}| j|d|tjj q.W dS )zDelete records. The first argument is always a name. The other arguments can be: - I{nothing} - rdataset... - rdata... - rdtype, [string...]Nr T)r r r r r lenr r r ANYr NONEr r r r! r$ r% r# r r )r r r' r( r r r) r r r r s6 z Update.deletec G s | j d| j|f| dS )aQ Replace records. The first argument is always a name. The other arguments can be: - rdataset... - ttl, rdata... - ttl, rdtype, string... Note that if you want to replace the entire node, you should do a delete of the name followed by one or more calls to add.TN)r* r )r r r' r r r r& s zUpdate.replacec G s t |trtjj|d}t|dkrL| j| j|tjj tj j tj j ddd nt |d tj j s|t |d tjjs|t|dkrt |d tj j st|}|jdd | jd| j|f| n@|d }t |trtj j|}| j| j|tjj |tj j ddd dS )aB Require that an owner name (and optionally an rdata type, or specific rdataset) exists as a prerequisite to the execution of the update. The first argument is always a name. The other arguments can be: - rdataset... - rdata... - rdtype, string...Nr Tr F)r r r r r r+ r answerr r, r r- r r r$ r% r! insertr* )r r r' r r r r present s* zUpdate.presentc C s t |trtjj|d}|dkrH| j| j|tjjtj j tj jddd n8t |tr^tj j|}| j| j|tjj|tj jddd dS )zRequire that an owner name (and optionally an rdata type) does not exist as a prerequisite to the execution of the update.NT) r r r r r r r. r r- r r, )r r r r r r absent s z Update.absent c s |dkr| j }tt| j||S )zcReturn a string containing the update in DNS compressed wire format. @rtype: stringN)r r r to_wire)r r Zmax_size)r r r r3 s zUpdate.to_wire)NN)N)Nr2 )__name__ __module__ __qualname__r r INZtsigZdefault_algorithmr r r* r r r& r0 r1 r3 __classcell__r r )r r r s % ( +$ r )__doc__Z dns.messager Zdns.nameZ dns.opcodeZ dns.rdataZdns.rdataclassZ dns.rdatasetZdns.tsigZ_compatr messageZMessager r r r r <module> s PK g\z} & & ) __pycache__/renderer.cpython-36.opt-1.pycnu [ 3 bW. @ sh d Z ddlmZ ddlZddlZddlZddlZddlZddl m Z dZ dZ dZ dZG dd d eZdS ) z*Help for building DNS wire format messages )BytesION )long c @ st e Zd ZdZdddZdd Zd d Zejj fd d Z d d Z dd Z dddZ ejjfddZdd Zdd ZdS )Rendererai Helper class for building DNS wire-format messages. Most applications can use the higher-level L{dns.message.Message} class and its to_wire() method to generate wire-format messages. This class is for those applications which need finer control over the generation of messages. Typical use:: r = dns.renderer.Renderer(id=1, flags=0x80, max_size=512) r.add_question(qname, qtype, qclass) r.add_rrset(dns.renderer.ANSWER, rrset_1) r.add_rrset(dns.renderer.ANSWER, rrset_2) r.add_rrset(dns.renderer.AUTHORITY, ns_rrset) r.add_edns(0, 0, 4096) r.add_rrset(dns.renderer.ADDTIONAL, ad_rrset_1) r.add_rrset(dns.renderer.ADDTIONAL, ad_rrset_2) r.write_header() r.add_tsig(keyname, secret, 300, 1, 0, '', request_mac) wire = r.get_wire() @ivar output: where rendering is written @type output: BytesIO object @ivar id: the message id @type id: int @ivar flags: the message flags @type flags: int @ivar max_size: the maximum size of the message @type max_size: int @ivar origin: the origin to use when rendering relative names @type origin: dns.name.Name object @ivar compress: the compression table @type compress: dict @ivar section: the section currently being rendered @type section: int (dns.renderer.QUESTION, dns.renderer.ANSWER, dns.renderer.AUTHORITY, or dns.renderer.ADDITIONAL) @ivar counts: list of the number of RRs in each section @type counts: int list of length 4 @ivar mac: the MAC of the rendered message (if TSIG was used) @type mac: string Nr c C sh t | _|dkr tjdd| _n|| _|| _|| _|| _i | _t | _ ddddg| _ | jj d d| _ dS )a Initialize a new renderer. @param id: the message id @type id: int @param flags: the DNS message flags @type flags: int @param max_size: the maximum message size; the default is 65535. If rendering results in a message greater than I{max_size}, then L{dns.exception.TooBig} will be raised. @type max_size: int @param origin: the origin to use when rendering relative names @type origin: dns.name.Name or None. Nr i s )r outputrandomZrandintidflagsmax_sizeorigincompressQUESTIONsectioncountswritemac)selfr r r r r /usr/lib/python3.6/renderer.py__init__N s zRenderer.__init__c C s^ | j j| | j j g }x(| jj D ]\}}||kr&|j| q&W x|D ] }| j|= qJW dS )zTruncate the output buffer at offset I{where}, and remove any compression table entries that pointed beyond the truncation point. @param where: the offset @type where: int N)r seektruncater itemsappend)r whereZkeys_to_deletekvr r r _rollbackk s zRenderer._rollbackc C s& | j |kr"| j |kr tjj|| _ dS )aZ Set the renderer's current section. Sections must be rendered order: QUESTION, ANSWER, AUTHORITY, ADDITIONAL. Sections may be empty. @param section: the section @type section: int @raises dns.exception.FormError: an attempt was made to set a section value less than the current section. N)r dns exceptionZ FormError)r r r r r _set_section} s zRenderer._set_sectionc C sz | j t | jj }|j| j| j| j | jjtj d|| | jj }|| j krd| j | t j j| jt d7 < dS )a Add a question to the message. @param qname: the question name @type qname: dns.name.Name @param rdtype: the question rdata type @type rdtype: int @param rdclass: the question rdata class @type rdclass: int z!HHr N)r& r r tellto_wirer r r structpackr r# r$ r% TooBigr )r ZqnameZrdtypeZrdclassbeforeafterr r r add_question s zRenderer.add_questionc K sh | j | | jj }|j| j| j| jf|}| jj }|| jkrR| j| tj j | j | |7 < dS )a Add the rrset to the specified section. Any keyword arguments are passed on to the rdataset's to_wire() routine. @param section: the section @type section: int @param rrset: the rrset @type rrset: dns.rrset.RRset object N) r& r r' r( r r r r# r$ r% r+ r )r r Zrrsetkwr, nr- r r r add_rrset s zRenderer.add_rrsetc K sj | j | | jj }|j|| j| j| jf|}| jj }|| jkrT| j| tj j | j | |7 < dS )a Add the rdataset to the specified section, using the specified name as the owner name. Any keyword arguments are passed on to the rdataset's to_wire() routine. @param section: the section @type section: int @param name: the owner name @type name: dns.name.Name object @param rdataset: the rdataset @type rdataset: dns.rdataset.Rdataset object N) r& r r' r( r r r r# r$ r% r+ r )r r nameZrdatasetr/ r, r0 r- r r r add_rdataset s zRenderer.add_rdatasetc C sf |t dM }||d> O }| jt | jj }| jjtjddtj j ||d |dk r(| jj }x|D ]z}tjd|j d}| jj| | jj } |j | j | jj } | jj | d tjd| | }| jj| | jj dd qfW | jj } | jj |d tjd| | }| jj| | jj dd | jj } | | jkrP| j| tjj| jt d 7 < dS ) a Add an EDNS OPT record to the message. @param edns: The EDNS level to use. @type edns: int @param ednsflags: EDNS flag values. @type ednsflags: int @param payload: The EDNS sender's payload field, which is the maximum size of UDP datagram the sender can handle. @type payload: int @param options: The EDNS options list @type options: list of dns.edns.Option instances @see: RFC 2671 l ~ z!BHHIHr Nz!HHr z!Hr )r r& ADDITIONALr r' r r) r* r$ rdatatypeOPTZotyper( r r r# r% r+ r ) r ZednsZ ednsflagsZpayloadZoptionsr, ZlstartoptZstuffstartendZlendr- r r r add_edns s8 zRenderer.add_ednsc C s2 | j t | jj } | jj } tjj| ||tt j ||||||d \} | _ } |j | j| j | j | jjtjdtjjtjjdd | jj } | jj| | jj }|| jkr| j| tjj| jj| d | jjtjd|| | jt d7 < | jjd | jjtjd| jt | jjdd dS ) a Add a TSIG signature to the message. @param keyname: the TSIG key name @type keyname: dns.name.Name object @param secret: the secret to use @type secret: string @param fudge: TSIG time fudge @type fudge: int @param id: the message id to encode in the tsig signature @type id: int @param tsig_error: TSIG error code; default is 0. @type tsig_error: int @param other_data: TSIG other data. @type other_data: string @param request_mac: This message is a response to the request which had the specified MAC. @type request_mac: string @param algorithm: the TSIG algorithm to use @type algorithm: dns.name.Name object ) algorithmz!HHIHr r z!Hr N)r& r5 r r' getvaluer$ tsigZsigninttimer r( r r r r) r* r6 ZTSIG rdataclassANYr r# r% r+ r r )r ZkeynameZsecretZfudger Z tsig_errorZ other_dataZ request_macr< r, sZ tsig_rdataZctxZ rdata_startr- r r r add_tsig s8 zRenderer.add_tsigc C sX | j jd | j jtjd| j| j| jd | jd | jd | jd | j jdd dS )zWrite the DNS message header. Writing the DNS message header is done after all sections have been rendered, but before the optional TSIG signature is added. r z!HHHHHHr r r N)r r r r) r* r r r )r r r r write_header5 s zRenderer.write_headerc C s | j j S )z@Return the wire format message. @rtype: string )r r> )r r r r get_wireC s zRenderer.get_wire)Nr r N)N)__name__ __module__ __qualname____doc__r r# r& r$ rB INr. r1 r3 r; r? Zdefault_algorithmrE rF rG r r r r r " s * 04r )rK ior r) r rA Z dns.exceptionr$ Zdns.tsigZ_compatr r ZANSWERZ AUTHORITYr5 objectr r r r r <module> s PK g\" __pycache__/inet.cpython-36.pycnu [ 3 bW @ sj d Z ddlZddlZddlZejZy ejZW n ek rD dZY nX dd Zdd Z dd Z d d Z dS ) z*Generic Internet address helper functions. Ni' c C s0 | t krtjj|S | tkr(tjj|S tdS )a* Convert the textual form of a network address into its binary form. @param family: the address family @type family: int @param text: the textual address @type text: string @raises NotImplementedError: the address family specified is not implemented. @rtype: string N)AF_INETdnsipv4 inet_atonAF_INET6ipv6NotImplementedError)familytext r /usr/lib/python3.6/inet.py inet_pton& s r c C s0 | t krtjj|S | tkr(tjj|S tdS )a/ Convert the binary form of a network address into its textual form. @param family: the address family @type family: int @param address: the binary address @type address: string @raises NotImplementedError: the address family specified is not implemented. @rtype: string N)r r r Z inet_ntoar r r )r Zaddressr r r inet_ntop: s r c C sL yt jj| tS tk rF yt jj| tS tY nX Y nX dS )zDetermine the address family of a textual-form network address. @param text: the textual address @type text: string @raises ValueError: the address family cannot be determined from the input. @rtype: int N)r r r r Exceptionr r ValueError)r r r r af_for_addressM s r c C st y$t tjj| d }|dko$|dkS tk rn y t tjj| d }|dkS tk rh tY nX Y nX dS )zIs the textual-form network address a multicast address? @param text: the textual address @raises ValueError: the address family cannot be determined from the input. @rtype: bool r N)ordr r r r r r )r firstr r r is_multicast` s r ) __doc__ZsocketZdns.ipv4r Zdns.ipv6r r AttributeErrorr r r r r r r r <module> s PK g\pp $ __pycache__/rdatatype.cpython-36.pycnu [ 3 W F @ s0 d Z ddlZddlZdZdZdZdZdZdZ dZ d Z d Z d Z d Zd ZdZdZdZdZdZdZdZdZdZdZdZdZdZ dZ d Z d Z d Z d Z!d Z"d!Z#d"Z$d#Z%d$Z&d%Z'd&Z(d'Z)d(Z*d)Z+d*Z,d+Z-d,Z.d-Z/d.Z0d/Z1d0Z2d1Z3d2Z4d3Z5d4Z6d5Z7d6Z8d7Z9d8Z:d9Z;d:Z<d;Z=d<Z>d=Z?d>Z@d?ZAd@ZBdAZCdBZDdCZEdDZFdEZGdFZHeeeeee e e e e eeeeeeeeeeeeeee e e e e e!e"e#e$e%e&e'e(e)e*e+e,e-e.e/e0e1e2e3e4e5e6e7e8e9e:e;e<e=e>e?e@eAeBeCeDeEeFeGeHdGEZIeJdHdI eIjK D ZLe)dJiZMe dJe"dJe(dJe/dJiZNejOdKejPZQG dLdM dMejRjSZTdNdO ZUdPdQ ZVdRdS ZWdTdU ZXdS )Va DNS Rdata Types. @var _by_text: The rdata type textual name to value mapping @type _by_text: dict @var _by_value: The rdata type value to textual name mapping @type _by_value: dict @var _metatypes: If an rdatatype is a metatype, there will be a mapping whose key is the rdatatype value and whose value is True in this dictionary. @type _metatypes: dict @var _singletons: If an rdatatype is a singleton, there will be a mapping whose key is the rdatatype value and whose value is True in this dictionary. @type _singletons: dict N ! # $ % & ' ) * + , - . / 0 1 2 3 4 7 ; < > c g l m i i i i )ENONEANSMDMFCNAMESOAMBMGMRNULLWKSPTRHINFOMINFOMXTXTRPAFSDBX25ISDNRTNSAPzNSAP-PTRSIGKEYPXGPOSAAAALOCNXTSRVNAPTRKXCERTA6DNAMEOPTAPLDSSSHFPIPSECKEYRRSIGNSECDNSKEYDHCIDNSEC3 NSEC3PARAMTLSAHIPCDSCDNSKEYCSYNCSPFUNSPECEUI48EUI64TKEYTSIGIXFRAXFRMAILBMAILAANYURICAAAVCTADLVc c s | ]\}}||fV qd S )N ).0xyr r /usr/lib/python3.6/rdatatype.py <genexpr> s r Tz TYPE([0-9]+)$c @ s e Zd ZdZdS )UnknownRdatatypez$DNS resource record type is unknown.N)__name__ __module__ __qualname____doc__r r r r r s r c C sV t j| j }|dkrRtj| }|dkr,tt|jd}|dk sJ|dkrRtd|S )zConvert text into a DNS rdata type value. @param text: the text @type text: string @raises dns.rdatatype.UnknownRdatatype: the type is unknown @raises ValueError: the rdata type value is not >= 0 and <= 65535 @rtype: intNr r i z&type must be between >= 0 and <= 65535) _by_textgetupper_unknown_type_patternmatchr intgroup ValueError)textvaluer r r r from_text s r c C s: | dk s| dkrt dtj| }|dkr6dt| }|S )zConvert a DNS rdata type to text. @param value: the rdata type value @type value: int @raises ValueError: the rdata type value is not >= 0 and <= 65535 @rtype: stringr i z&type must be between >= 0 and <= 65535NZTYPE)r _by_valuer repr)r r r r r to_text s r c C s | t kr| tks| tkr dS dS )zbTrue if the type is a metatype. @param rdtype: the type @type rdtype: int @rtype: boolTF)rz r _metatypes)rdtyper r r is_metatype s r c C s | t kr dS dS )zcTrue if the type is a singleton. @param rdtype: the type @type rdtype: int @rtype: boolTF) _singletons)r r r r is_singleton s r )Yr reZ dns.exceptionZdnsrB rC rD rE rF rG rH rI rJ rK rL rM rN rO rP rQ rR rS rT rU rV rW rX ZNSAP_PTRrY rZ r[ r\ r] r^ r_ r` ra rb rc rd re rf rg rh ri rj rk rl rm rn ro rp rq rr rs rt ru rv rw rx ry rz r{ r| r} r~ r r r r r r r r dictitemsr r r compileIr Z exceptionZ DNSExceptionr r r r r r r r r <module> s0 PK g\-^L % __pycache__/hash.cpython-36.opt-1.pycnu [ 3 bWL @ sX d Z ddlZi Zejed< ejed< ejed< ejed< ejed< ejed< d d Z dS ) z'Hashing backwards compatibility wrapper NZMD5ZSHA1ZSHA224ZSHA256ZSHA384ZSHA512c C s t | j S )N)hashesupper) algorithm r /usr/lib/python3.6/hash.pyget s r ) __doc__Zhashlibr Zmd5Zsha1Zsha224Zsha256Zsha384Zsha512r r r r r <module> s PK g\VJ8 8 * __pycache__/tokenizer.cpython-36.opt-1.pycnu [ 3 bWG @ s d Z ddlmZ ddlZddlZddlZddlZddlm Z m Z m Z ddddddddZ ddiZ dZdZd Zd Zd Zd Zd ZG dd dejjZG dd deZG dd deZdS )z Tokenize DNS master file format )StringION )long text_type binary_typeT) ;()"r c @ s e Zd ZdZdS )UngetBufferFullzDAn attempt was made to unget a token when the unget buffer was full.N)__name__ __module__ __qualname____doc__ r r /usr/lib/python3.6/tokenizer.pyr . s r c @ s e Zd ZdZd%ddZdd Zdd Zd d Zd d Zdd Z dd Z dd Z dd Z dd Z dd Zdd Zd d Zd d Zd d! Zd"d# Zd$S )&TokenzA DNS master file format token. @ivar ttype: The token type @type ttype: int @ivar value: The token value @type value: string @ivar has_escape: Does the token value contain escapes? @type has_escape: bool Fc C s || _ || _|| _dS )a Initialize a token instance. @param ttype: The token type @type ttype: int @param value: The token value @type value: string @param has_escape: Does the token value contain escapes? @type has_escape: bool N)ttypevalue has_escape)selfr r r r r r __init__? s zToken.__init__c C s | j tkS )N)r EOF)r r r r is_eofM s z Token.is_eofc C s | j tkS )N)r EOL)r r r r is_eolP s z Token.is_eolc C s | j tkS )N)r WHITESPACE)r r r r is_whitespaceS s zToken.is_whitespacec C s | j tkS )N)r IDENTIFIER)r r r r is_identifierV s zToken.is_identifierc C s | j tkS )N)r QUOTED_STRING)r r r r is_quoted_stringY s zToken.is_quoted_stringc C s | j tkS )N)r COMMENT)r r r r is_comment\ s zToken.is_commentc C s | j tkS )N)r DELIMITER)r r r r is_delimiter_ s zToken.is_delimiterc C s | j tkp| j tkS )N)r r# r! )r r r r is_eol_or_eofb s zToken.is_eol_or_eofc C s& t |tsdS | j|jko$| j|jkS )NF) isinstancer r r )r otherr r r __eq__e s z Token.__eq__c C s& t |tsdS | j|jkp$| j|jkS )NT)r0 r r r )r r1 r r r __ne__k s z Token.__ne__c C s d| j | jf S )Nz%d "%s")r r )r r r r __str__q s z Token.__str__c C s | j s | S d}t| j}d}x||k r| j| }|d7 }|dkr||krPtjj| j| }|d7 }|j r||krztjj| j| }|d7 }||krtjj| j| }|d7 }|j o|j stjjtt |d t |d t | }||7 }q W t | j |S )Nr r r \d ) r lenr dns exception UnexpectedEndisdigit SyntaxErrorchrintr r )r Z unescapedlicc2c3r r r unescapet s6 $ zToken.unescapec C s dS )Nr r )r r r r __len__ s z Token.__len__c C s t | j| jfS )N)iterr r )r r r r __iter__ s zToken.__iter__c C s$ |dkr| j S |dkr | jS td S )Nr r )r r IndexError)r rA r r r __getitem__ s zToken.__getitem__N)r F)r r r r r r" r$ r& r( r* r, r. r/ r2 r3 r4 rE rF rH rJ r r r r r 3 s" r c @ s e Zd ZdZejdfddZdd Zdd Zd d Z d d Z d(ddZ dd Z dd Z e Zdd Zdd Zdd Zdd Zd d Zd)d d Zd*d d!Zd+d"d#Zd$d% Zd&d' ZdS ), Tokenizera A DNS master file format tokenizer. A token is a (type, value) tuple, where I{type} is an int, and I{value} is a string. The valid types are EOF, EOL, WHITESPACE, IDENTIFIER, QUOTED_STRING, COMMENT, and DELIMITER. @ivar file: The file to tokenize @type file: file @ivar ungotten_char: The most recently ungotten character, or None. @type ungotten_char: string @ivar ungotten_token: The most recently ungotten token, or None. @type ungotten_token: (int, string) token tuple @ivar multiline: The current multiline level. This value is increased by one every time a '(' delimiter is read, and decreased by one every time a ')' delimiter is read. @type multiline: int @ivar quoting: This variable is true if the tokenizer is currently reading a quoted string. @type quoting: bool @ivar eof: This variable is true if the tokenizer has encountered EOF. @type eof: bool @ivar delimiters: The current delimiter dictionary. @type delimiters: dict @ivar line_number: The current line number @type line_number: int @ivar filename: A filename that will be returned by the L{where} method. @type filename: string Nc C s t |tr t|}|dkr`d}n@t |trDt|j }|dkr`d}n |dkr`|tjkr\d}nd}|| _d| _d| _ d| _ d| _ d| _ t | _d| _|| _dS )a Initialize a tokenizer instance. @param f: The file to tokenize. The default is sys.stdin. This parameter may also be a string, in which case the tokenizer will take its input from the contents of the string. @type f: file or string @param filename: the name of the filename that the L{where} method will return. @type filename: string Nz<string>z<stdin>z<file>r Fr )r0 r r r decodesysstdinfile ungotten_charungotten_token multilinequotingeof _DELIMITERS delimiters line_numberfilename)r frX r r r r s* zTokenizer.__init__c C sZ | j dkrJ| jrd}qV| jjd}|dkr2d| _qV|dkrV| jd7 _n | j }d| _ |S )z<Read a character from input. @rtype: string Nr r Tr )rP rT rO readrW )r rB r r r _get_char s zTokenizer._get_charc C s | j | jfS )zReturn the current location in the input. @rtype: (string, int) tuple. The first item is the filename of the input, the second is the current line number. )rX rW )r r r r where s zTokenizer.wherec C s | j dk rt|| _ dS )aE Unget a character. The unget buffer for characters is only one character large; it is an error to try to unget a character when the unget buffer is not empty. @param c: the character to unget @type c: string @raises UngetBufferFull: there is already an ungotten char N)rP r )r rB r r r _unget_char s zTokenizer._unget_charc C sL d}xB| j }|dkr<|dkr<|dks.| j r<| j| |S |d7 }qW dS )a( Consume input until a non-whitespace character is encountered. The non-whitespace character is then ungotten, and the number of whitespace characters consumed is returned. If the tokenizer is in multiline mode, then newlines are whitespace. @rtype: int r r r r r N)r[ rR r] )r skippedrB r r r skip_whitespace s zTokenizer.skip_whitespaceFc C sT | j dk r>| j }d| _ |j r(|r>|S n|j r:|r>|S n|S | j }|r\|dkr\ttdS d}t}d}x| j }|dks|| jkr|dkr| j rt j j |dko|t kr|dkr| jd7 _| j qlq |dkr | jdkrt j j| jd8 _| j qln|d krH| j s0d | _ t| _t }qlnd| _ t| _| j qln|d kr\ttd S |d krx,| j }|d ks|dkrP ||7 }qhW |r| j| tt|S |dkr| jrt j jd ttS | jr| j d}qln ttd S n|}t}n | j| P n| j r|dkr| j }|dkr>t j j |j r| j }|dkrbt j j | j } |dkr|t j j |j o| j st j jtt|d t|d t| }n|d krt j jdn:|dkr||7 }d }| j }|dks|d krt j j ||7 }qlW |dkrH|t krH| jrDt j jd t}t|||S )a Get the next token. @param want_leading: If True, return a WHITESPACE token if the first character read is whitespace. The default is False. @type want_leading: bool @param want_comment: If True, return a COMMENT token if the first token read is a comment. The default is False. @type want_comment: bool @rtype: Token object @raises dns.exception.UnexpectedEnd: input ended prematurely @raises dns.exception.SyntaxError: input was badly formed Nr r r Fr r r r Tr r zunbalanced parenthesesr5 r6 r7 znewline in quoted string)rQ r& r, r_ r r% r' r[ rV rS r9 r: r; r) rR r= _QUOTING_DELIMITERSrU r# r] r+ r! r- r< r> r? ) r Z want_leadingZ want_commenttokenr^ r r rB rC rD r r r get% s & z Tokenizer.getc C s | j dk rt|| _ dS )a@ Unget a token. The unget buffer for tokens is only one token large; it is an error to try to unget a token when the unget buffer is not empty. @param token: the token to unget @type token: Token object @raises UngetBufferFull: there is already an ungotten token N)rQ r )r ra r r r unget s zTokenizer.ungetc C s | j }|j rt|S )zLReturn the next item in an iteration. @rtype: (int, string) )rb r" StopIteration)r ra r r r next s zTokenizer.nextc C s | S )Nr )r r r r rH s zTokenizer.__iter__c C s@ | j j }|j s tjjd|jj s6tjjdt|jS )z|Read the next token and interpret it as an integer. @raises dns.exception.SyntaxError: @rtype: int zexpecting an identifierzexpecting an integer) rb rE r( r9 r: r= r r< r? )r ra r r r get_int s zTokenizer.get_intc C s, | j }|dk s|dkr(tjjd| |S )zRead the next token and interpret it as an 8-bit unsigned integer. @raises dns.exception.SyntaxError: @rtype: int r z#%d is not an unsigned 8-bit integer)rf r9 r: r= )r r r r r get_uint8 s zTokenizer.get_uint8c C s, | j }|dk s|dkr(tjjd| |S )zRead the next token and interpret it as a 16-bit unsigned integer. @raises dns.exception.SyntaxError: @rtype: int r i z$%d is not an unsigned 16-bit integer)rf r9 r: r= )r r r r r get_uint16 s zTokenizer.get_uint16c C sh | j j }|j s tjjd|jj s6tjjdt|j}|dk sT|tdkrdtjjd| |S )zRead the next token and interpret it as a 32-bit unsigned integer. @raises dns.exception.SyntaxError: @rtype: int zexpecting an identifierzexpecting an integerr l z$%d is not an unsigned 32-bit integer) rb rE r( r9 r: r= r r< r )r ra r r r r get_uint32 s zTokenizer.get_uint32c C s. | j j }|j p|j s(tjjd|jS )z}Read the next token and interpret it as a string. @raises dns.exception.SyntaxError: @rtype: string zexpecting a string)rb rE r( r* r9 r: r= r )r originra r r r get_string s zTokenizer.get_stringc C s& | j j }|j s tjjd|jS )zRead the next token and raise an exception if it is not an identifier. @raises dns.exception.SyntaxError: @rtype: string zexpecting an identifier)rb rE r( r9 r: r= r )r rk ra r r r get_identifier s zTokenizer.get_identifierc C s, | j }|j s tjjdtjj|j|S )zRead the next token and interpret it as a DNS name. @raises dns.exception.SyntaxError: @rtype: dns.name.Name objectzexpecting an identifier)rb r( r9 r: r= name from_textr )r rk ra r r r get_name s zTokenizer.get_namec C s. | j }|j s(tjjd|j|jf |jS )zRead the next token and raise an exception if it isn't EOL or EOF. @raises dns.exception.SyntaxError: @rtype: string z expected EOL or EOF, got %d "%s")rb r/ r9 r: r= r r )r ra r r r get_eol! s zTokenizer.get_eolc C s. | j j }|j s tjjdtjj|jS )Nzexpecting an identifier) rb rE r( r9 r: r= Zttlro r )r ra r r r get_ttl0 s zTokenizer.get_ttl)FF)N)N)N)r r r r rM rN r r[ r\ r] r_ rb rc re __next__rH rf rh ri rj rl rm rp rq rr r r r r rK s( $ { rK )r ior rM Z dns.exceptionr9 Zdns.nameZdns.ttlZ_compatr r r rU r` r! r# r% r' r) r+ r- r: Z DNSExceptionr objectr rK r r r r <module> s0 oPK g\ % __pycache__/rdataclass.cpython-36.pycnu [ 3 bW @ s d Z ddlZddlZdZdZdZdZdZdZ eeeeee dZ e d d e j D Z e jeeed ed e d iZejd ejZG dd dejjZdd Zdd Zdd ZdS )ak DNS Rdata Classes. @var _by_text: The rdata class textual name to value mapping @type _by_text: dict @var _by_value: The rdata class value to textual name mapping @type _by_value: dict @var _metaclasses: If an rdataclass is a metaclass, there will be a mapping whose key is the rdatatype value and whose value is True in this dictionary. @type _metaclasses: dict N ) RESERVED0INCHHSNONEANYc c s | ]\}}||fV qd S )N ).0xyr r /usr/lib/python3.6/rdataclass.py <genexpr>2 s r )ZINTERNETZCHAOSZHESIODTzCLASS([0-9]+)$c @ s e Zd ZdZdS )UnknownRdataclasszA DNS class is unknown.N)__name__ __module__ __qualname____doc__r r r r r E s r c C sV t j| j }|dkrRtj| }|dkr,tt|jd}|dk sJ|dkrRtd|S )zConvert text into a DNS rdata class value. @param text: the text @type text: string @rtype: int @raises dns.rdataclass.UnknownRdataclass: the class is unknown @raises ValueError: the rdata class value is not >= 0 and <= 65535 Nr r i z'class must be between >= 0 and <= 65535) _by_textgetupper_unknown_class_patternmatchr intgroup ValueError)textvaluer r r r from_textJ s r" c C s: | dk s| dkrt dtj| }|dkr6dt| }|S )zConvert a DNS rdata class to text. @param value: the rdata class value @type value: int @rtype: string @raises ValueError: the rdata class value is not >= 0 and <= 65535 r i z'class must be between >= 0 and <= 65535NZCLASS)r _by_valuer repr)r! r r r r to_text^ s r% c C s | t kr dS dS )zmTrue if the class is a metaclass. @param rdclass: the rdata class @type rdclass: int @rtype: boolTF) _metaclasses)Zrdclassr r r is_metaclassn s r' )r reZ dns.exceptionZdnsr r r r r r r dictitemsr# updater& compileIr Z exceptionZ DNSExceptionr r" r% r' r r r r <module> s4 PK g\5 n n " __pycache__/message.cpython-36.pycnu [ 3 @Wy @ s d Z ddlmZ ddlmZ ddlZddlZddlZddl Zddl Zddl Zddl Zddl ZddlZddlZddlZddlZddlZddlZddlZddlZddlmZmZmZ G dd dejjZ G d d d ejjZ G d d d ejj Z G d d dejjZ G dd dejjZ!G dd dejj Z"G dd de#Z$G dd de#Z%d(ddZ&G d d d e#Z'd d Z(d d! Z)ej*j+ddddddfd"d#Z,d)d&d'Z-dS )*z DNS Messages )absolute_import)StringION )longxrange string_typesc @ s e Zd ZdZdS ) ShortHeaderz2The DNS packet passed to from_wire() is too short.N)__name__ __module__ __qualname____doc__ r r /usr/lib/python3.6/message.pyr * s r c @ s e Zd ZdZdS ) TrailingJunkzEThe DNS packet passed to from_wire() has extra junk at the end of it.N)r r r r r r r r r / s r c @ s e Zd ZdZdS )UnknownHeaderFieldzVThe header field name was not recognized when converting from text into a message.N)r r r r r r r r r 4 s r c @ s e Zd ZdZdS )BadEDNSzVOPT record occurred somewhere other than the start of the additional data section.N)r r r r r r r r r : s r c @ s e Zd ZdZdS )BadTSIGzWA TSIG record occurred somewhere other than the end of the additional data section.N)r r r r r r r r r @ s r c @ s e Zd ZdZdS )UnknownTSIGKeyz(A TSIG with an unknown key was received.N)r r r r r r r r r F s r c @ s e Zd ZdZd-ddZdd Zdd Zd.d d Zd d Zdd Z dd Z dd Z e j jdddfddZe j jdddfddZd/ddZdd ddd e jjfd d Zd0d!d"Zd1d#d$Zd%d& Zd'd( Zd)d* Zd+d, ZdS )2Messagea, A DNS message. @ivar id: The query id; the default is a randomly chosen id. @type id: int @ivar flags: The DNS flags of the message. @see: RFC 1035 for an explanation of these flags. @type flags: int @ivar question: The question section. @type question: list of dns.rrset.RRset objects @ivar answer: The answer section. @type answer: list of dns.rrset.RRset objects @ivar authority: The authority section. @type authority: list of dns.rrset.RRset objects @ivar additional: The additional data section. @type additional: list of dns.rrset.RRset objects @ivar edns: The EDNS level to use. The default is -1, no Edns. @type edns: int @ivar ednsflags: The EDNS flags @type ednsflags: long @ivar payload: The EDNS payload size. The default is 0. @type payload: int @ivar options: The EDNS options @type options: list of dns.edns.Option objects @ivar request_payload: The associated request's EDNS payload size. @type request_payload: int @ivar keyring: The TSIG keyring to use. The default is None. @type keyring: dict @ivar keyname: The TSIG keyname to use. The default is None. @type keyname: dns.name.Name object @ivar keyalgorithm: The TSIG algorithm to use; defaults to dns.tsig.default_algorithm. Constants for TSIG algorithms are defined in dns.tsig, and the currently implemented algorithms are HMAC_MD5, HMAC_SHA1, HMAC_SHA224, HMAC_SHA256, HMAC_SHA384, and HMAC_SHA512. @type keyalgorithm: string @ivar request_mac: The TSIG MAC of the request message associated with this message; used when validating TSIG signatures. @see: RFC 2845 for more information on TSIG fields. @type request_mac: string @ivar fudge: TSIG time fudge; default is 300 seconds. @type fudge: int @ivar original_id: TSIG original id; defaults to the message's id @type original_id: int @ivar tsig_error: TSIG error code; default is 0. @type tsig_error: int @ivar other_data: TSIG other data. @type other_data: string @ivar mac: The TSIG MAC for this message. @type mac: string @ivar xfr: Is the message being used to contain the results of a DNS zone transfer? The default is False. @type xfr: bool @ivar origin: The origin of the zone in messages which are used for zone transfers or for DNS dynamic updates. The default is None. @type origin: dns.name.Name object @ivar tsig_ctx: The TSIG signature context associated with this message. The default is None. @type tsig_ctx: hmac.HMAC object @ivar had_tsig: Did the message decoded from wire format have a TSIG signature? @type had_tsig: bool @ivar multi: Is this message part of a multi-message sequence? The default is false. This variable is used when validating TSIG signatures on messages which are part of a zone transfer. @type multi: bool @ivar first: Is this message standalone, or the first of a multi message sequence? This variable is used when validating TSIG signatures on messages which are part of a zone transfer. @type first: bool @ivar index: An index of rrsets in the message. The index key is (section, name, rdclass, rdtype, covers, deleting). Indexing can be disabled by setting the index to None. @type index: dict Nc C s |d krt jj | _n|| _d| _g | _g | _g | _g | _d| _ d| _ d| _ g | _ d| _ d | _d | _t jj| _d| _d| _d| _d| _| j| _d| _d| _d | _d | _d| _ d| _ d| _ i | _ d S )Nr r i, FT) dnsZentropyZ random_16idflagsquestionanswer authority additionaledns ednsflagspayloadoptionsrequest_payloadkeyringkeynametsigdefault_algorithm keyalgorithm request_mac other_data tsig_errorfudge original_idmacxfrorigintsig_ctxhad_tsigmultifirstindex)selfr r r r __init__ s: zMessage.__init__c C s dt | j d S )Nz<DNS message, ID >)reprr )r5 r r r __repr__ s zMessage.__repr__c C s | j S )N)to_text)r5 r r r __str__ s zMessage.__str__Tc K s t }|jd| j |jdtjjtjj| j tjj| j| j }|jdtjj| |jdtjj| j | j dkr|jd| j | j dkr|jdtjj | j |jd| j tjj | j}|r|jd n |jd x.| jD ]$}|j|j||f| |jd qW |r,|jd n |jd x0| jD ]&}|j|j||f| |jd q>W |rz|jd n |jd x0| jD ]&}|j|j||f| |jd qW |jd x0| jD ]&}|j|j||f| |jd qW |j dd S )zConvert the message to text. The I{origin}, I{relativize}, and any other keyword arguments are passed to the rrset to_wire() method. @rtype: string zid %d z opcode %s z rcode %s z flags %s r zedns %s z eflags %s z payload %d z;ZONE z ;QUESTION z;PREREQ z;ANSWER z;UPDATE z ;AUTHORITY z ;ADDITIONAL Nr r )r writer r opcoder: from_flagsr rcoder r Z edns_to_textr is_updater r r r getvalue)r5 r/ relativizekwsZrcrA rrsetr r r r: sJ zMessage.to_textc C s t |tsdS | j|jkr dS | j|jkr.dS x | jD ]}||jkr6dS q6W x |jD ]}|| jkrTdS qTW x | jD ]}||jkrrdS qrW x |jD ]}|| jkrdS qW x | jD ]}||jkrdS qW x |jD ]}|| jkrdS qW dS )zTwo messages are equal if they have the same content in the header, question, answer, and authority sections. @rtype: boolFT) isinstancer r r r r r )r5 othernr r r __eq__ s2 zMessage.__eq__c C s | j | S )z0Are two messages not equal? @rtype: bool)rJ )r5 rH r r r __ne__ s zMessage.__ne__c C s |j tj j@ dks:| j|jks:tjj| j tjj|j kr>dS tjj|j |jtjjkr\dS tjj | j rndS x | j D ]}||j krvdS qvW x |j D ]}|| j krdS qW dS )z1Is other a response to self? @rtype: boolr FT) r r QRr r> r? r@ r ZNOERRORrA r )r5 rH rI r r r is_response s" zMessage.is_responsec C sD || j krdS || jkr dS || jkr*dS || jkr8dS tdd S )Nr r zunknown section)r r r r ValueError)r5 sectionr r r section_number- s zMessage.section_numberFc C s | j ||||||f} |sb| jdk r>| jj| } | dk rb| S n$x"|D ]} | j|||||rD| S qDW |sjttjj|||||} |j| | jdk r| | j| < | S )a Find the RRset with the given attributes in the specified section. @param section: the section of the message to look in, e.g. self.answer. @type section: list of dns.rrset.RRset objects @param name: the name of the RRset @type name: dns.name.Name object @param rdclass: the class of the RRset @type rdclass: int @param rdtype: the type of the RRset @type rdtype: int @param covers: the covers value of the RRset @type covers: int @param deleting: the deleting value of the RRset @type deleting: int @param create: If True, create the RRset if it is not found. The created RRset is appended to I{section}. @type create: bool @param force_unique: If True and create is also True, create a new RRset regardless of whether a matching RRset exists already. @type force_unique: bool @raises KeyError: the RRset was not found and create was False @rtype: dns.rrset.RRset objectN) rR r4 getmatchKeyErrorr rF ZRRsetappend) r5 rQ namerdclassrdtypecoversdeletingcreate force_uniquekeyrF r r r find_rrset9 s" zMessage.find_rrsetc C s: y | j ||||||||} W n tk r4 d} Y nX | S )a Get the RRset with the given attributes in the specified section. If the RRset is not found, None is returned. @param section: the section of the message to look in, e.g. self.answer. @type section: list of dns.rrset.RRset objects @param name: the name of the RRset @type name: dns.name.Name object @param rdclass: the class of the RRset @type rdclass: int @param rdtype: the type of the RRset @type rdtype: int @param covers: the covers value of the RRset @type covers: int @param deleting: the deleting value of the RRset @type deleting: int @param create: If True, create the RRset if it is not found. The created RRset is appended to I{section}. @type create: bool @param force_unique: If True and create is also True, create a new RRset regardless of whether a matching RRset exists already. @type force_unique: bool @rtype: dns.rrset.RRset object or NoneN)r_ rU ) r5 rQ rW rX rY rZ r[ r\ r] rF r r r get_rrsetg s zMessage.get_rrsetr c K sR |dkr | j dkr| j }nd}|dk r,d}n |dkr8d}tjj| j| j||}x"| jD ]}|j|j|j |j qVW x"| j D ]}|j tjj |f| qzW x"| jD ]}|j tjj|f| qW | jdkr|j| j| j| j| j x"| jD ]}|j tjj|f| qW |j | jdk rJ|j| j| j| j | j| j | j | j | j | j |j!| _!|j" S )a7 Return a string containing the message in DNS compressed wire format. Additional keyword arguments are passed to the rrset to_wire() method. @param origin: The origin to be appended to any relative names. @type origin: dns.name.Name object @param max_size: The maximum size of the wire format output; default is 0, which means 'the message's request payload, if nonzero, or 65536'. @type max_size: int @raises dns.exception.TooBig: max_size was exceeded @rtype: string r i i N)#r" r ZrendererZRendererr r r Z add_questionrW rY rX r Z add_rrsetANSWERr AUTHORITYr Zadd_ednsr r r! r ADDITIONALZ write_headerr$ Zadd_tsigr# r+ r, r* r) r( r' r- Zget_wire)r5 r/ Zmax_sizerD rrF r r r to_wire s6 zMessage.to_wirei, r c C st || _ |dkr$t| j j d | _n t|tr:tjj|}|| _|| _ || _ |dkr^| j | _ n|| _ || _ || _dS )aw When sending, a TSIG signature using the specified keyring and keyname should be added. @param keyring: The TSIG keyring to use; defaults to None. @type keyring: dict @param keyname: The name of the TSIG key to use; defaults to None. The key must be defined in the keyring. If a keyring is specified but a keyname is not, then the key used will be the first key in the keyring. Note that the order of keys in a dictionary is not defined, so applications should supply a keyname when a keyring is used, unless they know the keyring contains only one key. @type keyname: dns.name.Name or string @param fudge: TSIG time fudge; default is 300 seconds. @type fudge: int @param original_id: TSIG original id; defaults to the message's id @type original_id: int @param tsig_error: TSIG error code; default is 0. @type tsig_error: int @param other_data: TSIG other data. @type other_data: string @param algorithm: The TSIG algorithm to use; defaults to dns.tsig.default_algorithm Nr )r# listkeysr$ rG r r rW from_textr' r+ r r, r* r) )r5 r# r$ r+ r, r* r) algorithmr r r use_tsig s zMessage.use_tsig c C s |dks|dkrd}|dkr d}|dkr,|}|dk rFd}d}d}g }n$|t dM }||d> O }|dkrjg }|| _|| _|| _|| _|| _dS ) a_ Configure EDNS behavior. @param edns: The EDNS level to use. Specifying None, False, or -1 means 'do not use EDNS', and in this case the other parameters are ignored. Specifying True is equivalent to specifying 0, i.e. 'use EDNS0'. @type edns: int or bool or None @param ednsflags: EDNS flag values. @type ednsflags: int @param payload: The EDNS sender's payload field, which is the maximum size of UDP datagram the sender can handle. @type payload: int @param request_payload: The EDNS payload size to use when sending this message. If not specified, defaults to the value of payload. @type request_payload: int or None @param options: The EDNS options @type options: None or list of dns.edns.Option objects @see: RFC 2671 NFr Tr l ~ r )r r r r r! r" )r5 r r r r" r! r r r use_edns s( zMessage.use_ednsc C sL |r*| j dk r| j | jtjjO _n | j dkrH| jtjj M _dS )a Enable or disable 'DNSSEC desired' flag in requests. @param wanted: Is DNSSEC desired? If True, EDNS is enabled if required, and then the DO bit is set. If False, the DO bit is cleared if EDNS is enabled. @type wanted: bool r N)r rm r r r ZDO)r5 Zwantedr r r want_dnssec s zMessage.want_dnssecc C s t jj| j| jS )z.Return the rcode. @rtype: int )r r@ r? r r )r5 r r r r@ s z Message.rcodec C sj t jj|\}}| jdM _| j|O _| jtdM _| j|O _| jdkrf| jdk rfd| _dS )zPSet the rcode. @param rcode: the rcode @type rcode: int i i r N)r r@ to_flagsr r r r )r5 r@ valueZevaluer r r set_rcode" s zMessage.set_rcodec C s t jj| jS )z/Return the opcode. @rtype: int )r r> r? r )r5 r r r r> / s zMessage.opcodec C s( | j dM _ | j tjj|O _ dS )zTSet the opcode. @param opcode: the opcode @type opcode: int i N)r r r> ro )r5 r> r r r set_opcode5 s zMessage.set_opcode)N)NT)Nr )r r rk NN)T)r r r r r6 r9 r; r: rJ rK rM rR r rdatatypeNONEr_ r` re r% r& rj rm rn r@ rq r> rr r r r r r K s0 K 7 - ! .) * r c @ s2 e Zd ZdZd ddZdd Zdd Zd d Zd S ) _WireReadera Wire format reader. @ivar wire: the wire-format message. @type wire: string @ivar message: The message object being built @type message: dns.message.Message object @ivar current: When building a message object from wire format, this variable contains the offset from the beginning of wire of the next octet to be read. @type current: int @ivar updating: Is the message a dynamic update? @type updating: bool @ivar one_rr_per_rrset: Put each RR into its own RRset? @type one_rr_per_rrset: bool @ivar ignore_trailing: Ignore trailing junk at end of request? @type ignore_trailing: bool @ivar zone_rdclass: The class of the zone in messages which are DNS dynamic updates. @type zone_rdclass: int Fc C s@ t jj|| _|| _d| _d| _t jj| _ || _ || _ || _ d S )Nr F) r ZwiredataZ maybe_wrapwiremessagecurrentupdating rdataclassIN zone_rdclass question_onlyone_rr_per_rrsetignore_trailing)r5 rv rw r} r~ r r r r r6 U s z_WireReader.__init__c C s | j r|dkrtjjxtd|D ]}tjj| j| j\}}| j j dk rV|j | j j }| j| | _t j d| j| j| jd \}}| jd | _| j j| j j|||ddd | j r"|| _q"W dS )zRead the next I{qcount} records from the wire data and add them to the question section. @param qcount: the number of questions in the message @type qcount: intr r Nz!HH T)r\ r] )ry r exception FormErrorr rW from_wirerv rx rw r/ rC structunpackr_ r r| )r5 qcountiqnameusedrY rX r r r _get_question` s z_WireReader._get_questionc C sH | j s | jrd}nd}d}x&td|D ]}| j}tjj| j| j\}}|} | jj dk rh|j | jj }| j| | _t j d| j| j| jd \} } } } | jd | _| tj jkrn|| jjk s|rt| | j_| | j_| d@ d? | j_g | j_| j}| }xj|dkrdt j d | j||d \}}|d }tjj|| j||}| jjj| || }|d | }qW d}n| tj jkrH|| jjko||d kst| jjdkrtd | jjj| }|dkrtd | | | j_ tj j | j| j| \| j_ | j_ tj j!| j| |t"t#j# | jj$|| j| | jj%| jj&| jj' | j_%d| j_(n| dk rVd} | j r| tj)j*ksz| tj)j+kr| }| j,} nd}|tj)j*ks|tj)j+kr|| jj-krtj j+}d}n&tj.j| | | j| j| | jj }|j/ }| jj0r| tj j1krd}| jj2||| | ||d|}|dk r4|j3|| | j| | _q(W dS )a/ Read the next I{count} records from the wire data and add them to the specified section. @param section: the section of the message to which to add records @type section: list of dns.rrset.RRset objects @param count: the number of records to read @type count: intTFr Nz!HHIH i rl z!HHr r z"got signed message without keyringzkey '%s' unknown)4ry r~ r rx r rW r rv rw r/ rC r r rs OPTr r r r r r! Zoption_from_wirerV ZTSIGr r# r rS r$ r% Zget_algorithm_and_macr' r- Zvalidateinttimer( r0 r2 r3 r1 rz ANYrt r| r rdatarZ r. ZSOAr_ add)r5 rQ countr] Zseen_optr Zrr_startrW r Z absolute_namerY rX ttlZrdlenrx ZoptslenZotypeZolenoptZsecretr[ rZ rdrF r r r _get_sectionx s z_WireReader._get_sectionc C s t | j}|dk rttjd| jdd \| j_| j_}}}}d| _t j j | jjr\d| _ | j | | jrpdS | j| jj| | j| jj| | j| jj| | j r| j|krt| jjr| jjr| jj r| jjj| j dS )zNRead a wire format DNS message and build a dns.message.Message object. z!HHHHHHNT)lenrv r r r rw r r rx r r> rA ry r r} r r r r r r r2 r0 r1 update)r5 lr ZancountZaucountZadcountr r r read s$ * z_WireReader.readN)FFF)r r r r r6 r r r r r r r ru > s cru r FTc C sP t dd} || _|| _|| _|| _|| _|| _|| _t| | || | } | j | S )a) Convert a DNS wire format message into a message object. @param keyring: The keyring to use if the message is signed. @type keyring: dict @param request_mac: If the message is a response to a TSIG-signed request, I{request_mac} should be set to the MAC of that request. @type request_mac: string @param xfr: Is this message part of a zone transfer? @type xfr: bool @param origin: If the message is part of a zone transfer, I{origin} should be the origin name of the zone. @type origin: dns.name.Name object @param tsig_ctx: The ongoing TSIG context, used when validating zone transfers. @type tsig_ctx: hmac.HMAC object @param multi: Is this message part of a multiple message sequence? @type multi: bool @param first: Is this message standalone, or the first of a multi message sequence? @type first: bool @param question_only: Read only up to the end of the question section? @type question_only: bool @param one_rr_per_rrset: Put each RR into its own RRset @type one_rr_per_rrset: bool @param ignore_trailing: Ignore trailing junk at end of request? @type ignore_trailing: bool @raises ShortHeader: The message is less than 12 octets long. @raises TrailingJunk: There were octets in the message past the end of the proper DNS message. @raises BadEDNS: An OPT record was in the wrong section, or occurred more than once. @raises BadTSIG: A TSIG record was not the last record of the additional data section. @rtype: dns.message.Message objectr )r ) r r# r( r. r/ r0 r2 r3 ru r ) rv r# r( r. r/ r0 r2 r3 r} r~ r mreaderr r r r s ( r c @ s8 e Zd ZdZdd Zdd Zdd Zdd Zd d Zd S ) _TextReadera Text format reader. @ivar tok: the tokenizer @type tok: dns.tokenizer.Tokenizer object @ivar message: The message object being built @type message: dns.message.Message object @ivar updating: Is the message a dynamic update? @type updating: bool @ivar zone_rdclass: The class of the zone in messages which are DNS dynamic updates. @type zone_rdclass: int @ivar last_name: The most recently read name when building a message object from text format. @type last_name: dns.name.Name object c C s. || _ tjj|| _d | _tjj| _d| _ d S )NF) rw r Z tokenizer Tokenizertok last_namerz r{ r| ry )r5 textrw r r r r6 > s z_TextReader.__init__c C s | j j }|j}|dkr*| j j | j_n|dkrx>| j j }|j sT| j j| P | jjt jj |jB | j_q4W t j j | jjrd| _ n&|dkr| j j | j_| jj| jjd> B | j_n|dkr | jjdk rd| j_x| j j }|j s| j j| P | jjt jj|jB | j_qW n|dkrN| j j | j_| jjdk rd| j_nd|d kr| j j }| jjt j jt j j |B | j_n.|d kr| j j }| jjt jj | nt| j j d S ) z5Process one line from the text format header section.r r Tr rl Zeflagsr r r> r@ N)r rS rp Zget_intrw r is_identifierungetr r rh r> rA ry r r Zedns_from_textr Z get_stringro rq r@ r get_eol)r5 rQ tokenZwhatr r r r _header_lineE sR z_TextReader._header_linec C s | j jdd}|j s(tjj|jd| _| j}| j j }|j sHtj j y,tj j|j}| j j }|j srtj j W n: tj j k r tj j Y n t k r tj j }Y nX tjj|j}| jj| jj|||ddd | jr|| _| j j dS )z7Process one line from the text format question section.T) want_leadingN)r\ r] )r rS is_whitespacer rW rh rp r r r SyntaxErrorrz Exceptionr{ rs rw r_ r ry r| r )r5 rQ r rW rX rY r r r _question_lines s. z_TextReader._question_linec C s d}| j jdd}|j s,tjj|jd| _| j}| j j }|j sLtj j y*t |jd}| j j }|j sttj j W n6 tj j k r tj j Y n t k r d}Y nX yPtj j|j}| j j }|j stj j |tj jks|tj jk r|}| j}W n> tj j k r tj j Y n t k r< tj j}Y nX tjj|j}| j j }|j s| j j| tjj||| j d}|j } n d}tjj} | jj||||| |d| j} |dk r| j|| dS )zfProcess one line from the text format answer, authority, or additional data sections. NT)r r )r rS r r rW rh rp r r r r r r rz r rt r| r{ rs is_eol_or_eofr r rZ rw r_ ry r ) r5 rQ r[ r rW r rX rY r rZ rF r r r _rr_line sT z_TextReader._rr_linec C s | j }d}x| jjdd}|j r$P |j r|jj }|dkrF| j }nv|dksV|dkrf| j}| jj }nV|dksv|dkr| j }| jj }n6|dks|d kr| j }| jj }n|d kr| j }| jj }| jj q | jj| || q W dS ) zNRead a text format DNS message and build a dns.message.Message object.NTZHEADERZQUESTIONZZONEra ZPREREQrb ZUPDATErc )r r rS r Z is_commentrp upperr rw r r r r r r r )r5 Z line_methodrQ r ur r r r s4 z_TextReader.readN) r r r r r6 r r r r r r r r r , s . 5r c C s t }t| |}|j |S )zConvert the text format message into a message object. @param text: The text format message. @type text: string @raises UnknownHeaderField: @raises dns.exception.SyntaxError: @rtype: dns.message.Message object)r r r )r r r r r r rh s rh c C sF t }d}t| |r"t| |} d}nd}z t| }W d|r@| j X |S )a Read the next text format message from the specified file. @param f: file or string. If I{f} is a string, it is treated as the name of a file to open. @raises UnknownHeaderField: @raises dns.exception.SyntaxError: @rtype: dns.message.Message objectZrUTFN)r rG openrh close)fZstr_typeZoptsZ want_closer r r r from_file s r c C s t | trtjj| } t |tr,tjj|}t |trBtjj|}t } | jtjj O _| j | j | ||ddd i } |dk r|| d< |dkrd}|dk r|| d< |dkrd}|dk r|| d< |dkrd}|dk r|| d< |dkrd}|| d < | j f | | j | | S ) aV Make a query message. The query name, type, and class may all be specified either as objects of the appropriate type, or as strings. The query will have a randomly chosen query id, and its DNS flags will be set to dns.flags.RD. @param qname: The query name. @type qname: dns.name.Name object or string @param rdtype: The desired rdata type. @type rdtype: int @param rdclass: The desired rdata class; the default is class IN. @type rdclass: int @param use_edns: The EDNS level to use; the default is None (no EDNS). See the description of dns.message.Message.use_edns() for the possible values for use_edns and their meanings. @type use_edns: int or bool or None @param want_dnssec: Should the query indicate that DNSSEC is desired? @type want_dnssec: bool @param ednsflags: EDNS flag values. @type ednsflags: int @param payload: The EDNS sender's payload field, which is the maximum size of UDP datagram the sender can handle. @type payload: int @param request_payload: The EDNS payload size to use when sending this message. If not specified, defaults to the value of payload. @type request_payload: int or None @param options: The EDNS options @type options: None or list of dns.edns.Option objects @see: RFC 2671 @rtype: dns.message.Message objectT)r\ r] Nr r r r" r! r )rG r r rW rh rs rz r r RDr_ r rm rn ) r rY rX rm rn r r r" r! r kwargsr r r make_query s> $ r , c C s | j tj j@ rtjjdtjj| j}tj j| j tj j@ B |_ |rV| j tj j O _ |j | j t | j |_ | jdkr|jdd|| j | jr|j| j| j|ddd| j | j|_|S )a Make a message which is a response for the specified query. The message returned is really a response skeleton; it has all of the infrastructure required of a response, but none of the content. The response's question section is a shallow copy of the query's question section, so the query's question RRsets should not be changed. @param query: the query to respond to @type query: dns.message.Message object @param recursion_available: should RA be set in the response? @type recursion_available: bool @param our_payload: payload size to advertise in EDNS responses; default is 8192. @type our_payload: int @param fudge: TSIG time fudge; default is 300 seconds. @type fudge: int @rtype: dns.message.Message objectz&specified query message is not a queryr Nr )r r rL r r rw r r r ZRArr r> rf r r rm r r1 rj r# r$ r' r- r( )ZqueryZrecursion_availableZ our_payloadr+ Zresponser r r make_response\ s r ) Nr FNNFTFFF)Fr r ).r Z __future__r ior r r Zdns.ednsr Z dns.exceptionZ dns.flagsZdns.nameZ dns.opcodeZ dns.entropyZ dns.rcodeZ dns.rdataZdns.rdataclassZ dns.rdatatypeZ dns.rrsetZ dns.rendererZdns.tsigZ dns.wiredataZ_compatr r r r r r r Z DNSExceptionr r r r objectr ru r r rh r rz r{ r r r r r r <module> sX v 7 5 :F PK g\` 7 7 % __pycache__/edns.cpython-36.opt-1.pycnu [ 3 bW @ s@ d Z dZG dd deZG dd deZi Zdd Zdd Zd S ) z EDNS Options c @ sd e Zd ZdZdd Zdd Zedd Zdd Zd d Z d d Z dd Z dd Z dd Z dd ZdS )Optionz*Base class for all EDNS option types. c C s || _ dS )z\Initialize an option. @param otype: The rdata type @type otype: int N)otype)selfr r /usr/lib/python3.6/edns.py__init__ s zOption.__init__c C s t dS )z*Convert an option to wire format. N)NotImplementedError)r filer r r to_wire! s zOption.to_wirec C s t dS )a Build an EDNS option object from wire format @param otype: The option type @type otype: int @param wire: The wire-format message @type wire: string @param current: The offset in wire of the beginning of the rdata. @type current: int @param olen: The length of the wire-format option data @type olen: int @rtype: dns.edns.Option instanceN)r )clsr wirecurrentolenr r r from_wire& s zOption.from_wirec C s t dS )zCompare an EDNS option with another option of the same type. Return < 0 if self < other, 0 if self == other, and > 0 if self > other. N)r )r otherr r r _cmp5 s z Option._cmpc C s, t |tsdS | j|jkr dS | j|dkS )NF ) isinstancer r r )r r r r r __eq__< s z Option.__eq__c C s, t |tsdS | j|jkr dS | j|dkS )NFr )r r r r )r r r r r __ne__C s z Option.__ne__c C s* t |t s| j|jkr tS | j|dk S )Nr )r r r NotImplementedr )r r r r r __lt__J s z Option.__lt__c C s* t |t s| j|jkr tS | j|dkS )Nr )r r r r r )r r r r r __le__P s z Option.__le__c C s* t |t s| j|jkr tS | j|dkS )Nr )r r r r r )r r r r r __ge__V s z Option.__ge__c C s* t |t s| j|jkr tS | j|dkS )Nr )r r r r r )r r r r r __gt__\ s z Option.__gt__N)__name__ __module__ __qualname____doc__r r classmethodr r r r r r r r r r r r r s r c s< e Zd ZdZ fddZdd Zedd Zdd Z Z S ) GenericOptionzwGenerate Rdata Class This class is used for EDNS option types for which we have no better implementation. c s t t| j| || _d S )N)superr r data)r r r" ) __class__r r r k s zGenericOption.__init__c C s |j | j d S )N)writer" )r r r r r r o s zGenericOption.to_wirec C s | ||||| S )Nr )r r r r r r r r r r s zGenericOption.from_wirec C s$ | j |j krdS | j |j kr dS dS )Nr )r" )r r r r r r v s zGenericOption._cmp) r r r r r r r r r __classcell__r r )r# r r c s r c C s t j| }|d krt}|S )N)_type_to_classgetr )r r r r r get_option_class s r* c C s t | }|j| |||S )au Build an EDNS option object from wire format @param otype: The option type @type otype: int @param wire: The wire-format message @type wire: string @param current: The offset in wire of the beginning of the rdata. @type current: int @param olen: The length of the wire-format option data @type olen: int @rtype: dns.edns.Option instance)r* r )r r r r r r r r option_from_wire s r+ N)r ZNSIDobjectr r r( r* r+ r r r r <module> s NPK g\|g g % __pycache__/e164.cpython-36.opt-1.pycnu [ 3 bWK @ s\ d Z ddlZddlZddlZddlmZ ejjdZ e fddZ e dfd d Z d d d Z dS )zDNS E.164 helpers @var public_enum_domain: The DNS public ENUM domain, e164.arpa. @type public_enum_domain: dns.name.Name object N ) string_typesz e164.arpa.c C s, dd | D }|j tjjdj||dS )au Convert an E.164 number in textual form into a Name object whose value is the ENUM domain name for that number. @param text: an E.164 number in textual form. @type text: str @param origin: The domain in which the number should be constructed. The default is e164.arpa. @type origin: dns.name.Name object or None @rtype: dns.name.Name object c S s g | ]}|j r|qS )isdigit).0dr r /usr/lib/python3.6/e164.py <listcomp>) s z from_e164.<locals>.<listcomp>.)origin)reversednsname from_textjoin)textr partsr r r from_e164 s r Tc C sb |dk r| j |} dd | jD }t|t| jkr@tjjd|j dj|}|r^d| }|S )a Convert an ENUM domain name into an E.164 number. @param name: the ENUM domain name. @type name: dns.name.Name object. @param origin: A domain containing the ENUM domain name. The name is relativized to this domain before being converted to text. @type origin: dns.name.Name object or None @param want_plus_prefix: if True, add a '+' to the beginning of the returned number. @rtype: str Nc S s$ g | ] }|j rt|d kr|qS )r )r len)r r r r r r ; s zto_e164.<locals>.<listcomp>z$non-digit labels in ENUM domain name +)Z relativizeZlabelsr r Z exception SyntaxErrorr r )r r Zwant_plus_prefixZdlabelsr r r r to_e164. s r c C s |dkrt jj }t jj }xl|D ]d}t|tr<t jj|}t jj | |}y |j |dS t jjk r } z||7 }W Y dd}~X q"X q"W |dS )zLook for NAPTR RRs for the specified number in the specified domains. e.g. lookup('16505551212', ['e164.dnspython.org.', 'e164.arpa.']) NZNAPTR) r resolverZget_default_resolverZNXDOMAIN isinstancer r r Ze164r query)ZnumberZdomainsr Ze_nxZdomainZqnameer r r r E s r )N) __doc__Z dns.exceptionr Zdns.nameZ dns.resolverZ_compatr r r Zpublic_enum_domainr r r r r r r <module> s PK g\i i % __pycache__/name.cpython-36.opt-1.pycnu [ 3 Ofr @ s d Z ddlmZ ddlZddlZddlZddlZyddlZdZ W n e k rX dZ Y nX ddl Z ddl Z ddlmZmZmZmZmZ y ejZW n. ek r ddejd > d d ZY nX dZdZd Zd Zd ZG d d de j j Z G dd de j j Z G dd de j j Z!G dd de j j Z"G dd de j j#Z$G dd de j j Z%G dd de j j Z&G dd d e j j#Z'G d d d e j j#Z(G d d d e j j#Z)G d!d" d"e j j#Z*G d#d$ d$e+Z,G d%d& d&e,Z-G d'd( d(e,Z.e/d)Z0d*Z1e-dZ2e-dZ3e2Z4e.ddddZ5e.ddddZ6e.ddddZ7e.ddddZ8e5Z9d+d, Z:d-d. Z;d/d0 Z<G d1d2 d2e+Z=e=d3gZ>e=g Z?e>dfd4d5Z@e>dfd6d7ZAd8d9 ZBdS ):zDNS Names. @var root: The DNS root name. @type root: dns.name.Name object @var empty: The empty DNS name. @type empty: dns.name.Name object )BytesIONTF )long binary_type text_typeunichr maybe_decode P c @ s e Zd ZdZdS ) EmptyLabelzA DNS label is empty.N)__name__ __module__ __qualname____doc__ r r /usr/lib/python3.6/name.pyr 4 s r c @ s e Zd ZdZdS ) BadEscapez8An escaped code in a text format of DNS name is invalid.N)r r r r r r r r r 9 s r c @ s e Zd ZdZdS ) BadPointerz=A DNS compression pointer points forward instead of backward.N)r r r r r r r r r > s r c @ s e Zd ZdZdS ) BadLabelTypez2The label type in DNS name wire format is unknown.N)r r r r r r r r r C s r c @ s e Zd ZdZdS )NeedAbsoluteNameOrOriginzvAn attempt was made to convert a non-absolute name to wire when there was also a non-absolute (or missing) origin.N)r r r r r r r r r H s r c @ s e Zd ZdZdS ) NameTooLongz A DNS name is > 255 octets long.N)r r r r r r r r r N s r c @ s e Zd ZdZdS ) LabelTooLongz A DNS label is > 63 octets long.N)r r r r r r r r r S s r c @ s e Zd ZdZdS )AbsoluteConcatenationz]An attempt was made to append anything other than the empty name to an absolute DNS name.N)r r r r r r r r r X s r c @ s e Zd ZdZdS )NoParentzMAn attempt was made to get the parent of the root name or the empty name.N)r r r r r r r r r ^ s r c @ s e Zd ZdZdS ) NoIDNA2008zLIDNA 2008 processing was requested but the idna module is not available.N)r r r r r r r r r c s r c @ s e Zd ZdZedgZdZdS ) IDNAExceptionz$IDNA processing raised an exception.idna_exceptionz+IDNA processing exception: {idna_exception}N)r r r r setZ supp_kwargsZfmtr r r r r i s r c @ s8 e Zd ZdZdd Zdd Zdd Zdd Zd d Zd S ) IDNACodecz.Abstract base class for IDNA encoder/decoders.c C s d S )Nr )selfr r r __init__t s zIDNACodec.__init__c C s |j jdS )Ns xn--)lower startswith)r" labelr r r is_idnaw s zIDNACodec.is_idnac C s" x |D ]}t |dkrdS qW dS )N FT)ord)r" r& cr r r is_all_asciiz s zIDNACodec.is_all_asciic C s t d S )N)NotImplementedError)r" r& r r r encode s zIDNACodec.encodec C s` | j |rPy|dd jd}W qX tk rL } zt|dW Y d d }~X qXX nt|}t|S )Nr Zpunycode)r )r' decode Exceptionr r _escapify)r" r& er r r r. s zIDNACodec.decodeN) r r r r r# r' r+ r- r. r r r r r! p s r! c s6 e Zd ZdZd fdd Zdd Z fddZ ZS ) IDNA2003CodeczIDNA 2003 encoder/decoder.Fc s t t| j || _dS )a Initialize the IDNA 2003 encoder/decoder. @param strict_decode: If True, then IDNA2003 checking is done when decoding. This can cause failures if the name was encoded with IDNA2008. The default is False. @type strict_decode: bool N)superr2 r# strict_decode)r" r4 ) __class__r r r# s zIDNA2003Codec.__init__c C s6 |dkr dS y t jj|S tk r0 tY nX d S )N ) encodingsidnaZToASCII UnicodeErrorr )r" r& r r r r- s zIDNA2003Codec.encodec sd | j stt| j|S |dkr"dS yttjj|S tk r^ } zt |dW Y d d }~X nX d S )Nr7 r6 )r ) r4 r3 r2 r. r0 r8 r9 Z ToUnicoder/ r )r" r& r1 )r5 r r r. s zIDNA2003Codec.decode)F)r r r r r# r- r. __classcell__r r )r5 r r2 s r2 c s6 e Zd ZdZd fdd Zdd Z fddZ ZS ) IDNA2008CodeczIDNA 2008 encoder/decoder.Fc s* t t| j || _|| _|| _|| _dS )a Initialize the IDNA 2008 encoder/decoder. @param uts_46: If True, apply Unicode IDNA compatibility processing as described in Unicode Technical Standard #46 (U{http://unicode.org/reports/tr46/}). This parameter is only meaningful if IDNA 2008 is in use. If False, do not apply the mapping. The default is False @type uts_46: bool @param transitional: If True, use the "transitional" mode described in Unicode Technical Standard #46. This parameter is only meaningful if IDNA 2008 is in use. The default is False. @type transitional: bool @param allow_pure_ascii: If True, then a label which consists of only ASCII characters is allowed. This is less strict than regular IDNA 2008, but is also necessary for mixed names, e.g. a name with starting with "_sip._tcp." and ending in an IDN suffixm which would otherwise be disallowed. The default is False @type allow_pure_ascii: bool @param strict_decode: If True, then IDNA2008 checking is done when decoding. This can cause failures if the name was encoded with IDNA2003. The default is False. @type strict_decode: bool N)r3 r< r# uts_46 transitionalallow_pure_asciir4 )r" r= r> r? r4 )r5 r r r# s zIDNA2008Codec.__init__c C s |dkr dS | j r&| j|r&|jdS ts.ty | jrFtj|d| j}tj |S tj k r| } zt |dW Y d d }~X nX d S )Nr6 r7 asciiF)r ) r? r+ r- have_idna_2008r r= r9 uts46_remapr> Zalabel IDNAErrorr )r" r& r1 r r r r- s zIDNA2008Codec.encodec s | j stt| j|S |dkr"dS ts*ty"| jr@tj|dd}t tj |S tj k rz } zt |dW Y d d }~X nX d S )Nr7 r6 F)r ) r4 r3 r< r. rA r r= r9 rB r0 ZulabelrC r )r" r& r1 )r5 r r r. s zIDNA2008Codec.decode)FFFF)r r r r r# r- r. r; r r )r5 r r< s r< s "().;\@$z"().;\@$c C s t | trzd}t | tr | j } xTt| D ]H}|tkrH|dt| 7 }q*|dkrf|dk rf|t|7 }q*|d| 7 }q*W |S d}xD| D ]<}|tkr|d| 7 }q|dkr|dt| 7 }q||7 }qW |S )zaEscape the characters in label which need it. @returns: the escaped string @rtype: stringr6 \ r( z\%03d ) isinstancebytesr r- bytearray_escapedchr _escaped_textr) )r& textr* r r r r0 s& r0 c C s t | }d}d}d}xH| D ]@}t |}||d 7 }|dkr>t|dk rR|dkrR|}|d7 }qW |dkrjt|dkr||d krtdS )a/ Check for empty labels in the middle of a label sequence, labels that are too long, and for too many labels. @raises NameTooLong: the name as a whole is too long @raises EmptyLabel: a label is empty (i.e. the root label) and appears in a position other than the end of the label sequencer r ? r7 N)lenr r r )labelsltotalijr& Zllr r r _validate_labels s rW c C s( t | tr| S t | tr | j S td S )N)rG r r r- ValueError)r& r r r _ensure_bytes/ s rY c sD e Zd ZdZdgZ fddZdd Zdd Zd d Zd d Z fd dZ dd Z dd Z dd Z dd Zdd Zdd Zdd Zd d Zd d Zd!d" Zd#d$ Zd%d& Zd'd( Zd)d* Zd+d, ZdLd.d/ZdMd1d2ZdNd3d4Z dOd5d6Z d7d8 Z d9d: Z d;d< Z d=d> Z!d?d@ Z"dAdB Z#dCdD Z$dEdF Z%dPdHdIZ&dJdK Z' Z(S )QNamezA DNS name. The dns.name.Name class represents a DNS name as a tuple of labels. Instances of the class are immutable. @ivar labels: The tuple of labels in the name. Each label is a string of up to 63 octets.rR c s2 dd |D }t t| jdt| t| j dS )zInitialize a domain name from a list of labels. @param labels: the labels @type labels: any iterable whose values are strings c S s g | ] }t |qS r )rY ).0xr r r <listcomp>H s z!Name.__init__.<locals>.<listcomp>rR N)r3 rZ __setattr__tuplerW rR )r" rR )r5 r r r# C s z Name.__init__c C s t dd S )Nz+object doesn't support attribute assignment) TypeError)r" namevaluer r r r^ L s zName.__setattr__c C s t | jS )N)rZ rR )r" r r r __copy__O s z Name.__copy__c C s t tj| j|S )N)rZ copydeepcopyrR )r" memor r r __deepcopy__R s zName.__deepcopy__c C s d| j iS )NrR )rR )r" r r r __getstate__U s zName.__getstate__c s$ t t| jd|d t| j d S )NrR )r3 rZ r^ rW rR )r" state)r5 r r __setstate__X s zName.__setstate__c C s t | jdko| jd dkS )zXIs the most significant label of this name the root label? @rtype: bool r r r7 rP )rQ rR )r" r r r is_absolute\ s zName.is_absolutec C s t | jdko| jd dkS )z\Is this name wild? (I.e. Is the least significant label '*'?) @rtype: bool r *)rQ rR )r" r r r is_wildc s z Name.is_wildc C sJ t d}x4| jD ]*}x$t|j D ]}||d> | 7 }q"W qW t|t S )zHReturn a case-insensitive hash of the name. @rtype: int r r )r rR rI r$ intmaxint)r" hr& r* r r r __hash__j s z Name.__hash__c C s* | j }|j }||kr0|r&tddfS tddfS t| j}t|j}|| }|dk rZ|}n|}d}d} t} x|dkr|d8 }|d8 }|d8 }| j| j } |j| j } | | k rd}| dkrt} | || fS | | krd}| dkrt} | || fS | d7 } qlW |}|dk r t} n|dkr t} nt} | || fS )a Compare two names, returning a 3-tuple (relation, order, nlabels). I{relation} describes the relation ship between the names, and is one of: dns.name.NAMERELN_NONE, dns.name.NAMERELN_SUPERDOMAIN, dns.name.NAMERELN_SUBDOMAIN, dns.name.NAMERELN_EQUAL, or dns.name.NAMERELN_COMMONANCESTOR I{order} is < 0 if self < other, > 0 if self > other, and == 0 if self == other. A relative name is always less than an absolute name. If both names have the same relativity, then the DNSSEC order relation is used to order them. I{nlabels} is the number of significant labels that the two names have in common. r r rP rP ) rk NAMERELN_NONErQ rR r$ NAMERELN_COMMONANCESTORNAMERELN_SUPERDOMAINNAMERELN_SUBDOMAINNAMERELN_EQUAL) r" otherZsabsZoabsl1l2ZldiffrS orderZnlabelsZnamerelnZlabel1Zlabel2r r r fullcompareu sN zName.fullcomparec C s( | j |\}}}|tks |tkr$dS dS )zoIs self a subdomain of other? The notion of subdomain includes equality. @rtype: bool TF)r{ ru rv )r" rw nronlr r r is_subdomain s zName.is_subdomainc C s( | j |\}}}|tks |tkr$dS dS )zqIs self a superdomain of other? The notion of subdomain includes equality. @rtype: bool TF)r{ rt rv )r" rw r| r} r~ r r r is_superdomain s zName.is_superdomainc C s t dd | jD S )zReturn a name which is equal to the current name, but is in DNSSEC canonical form. @rtype: dns.name.Name object c S s g | ] }|j qS r )r$ )r[ r\ r r r r] s z%Name.canonicalize.<locals>.<listcomp>)rZ rR )r" r r r canonicalize s zName.canonicalizec C s$ t |tr | j|d dkS dS d S )Nr r F)rG rZ r{ )r" rw r r r __eq__ s z Name.__eq__c C s$ t |tr | j|d dkS dS d S )Nr r T)rG rZ r{ )r" rw r r r __ne__ s z Name.__ne__c C s$ t |tr | j|d dk S tS d S )Nr r )rG rZ r{ NotImplemented)r" rw r r r __lt__ s z Name.__lt__c C s$ t |tr | j|d dkS tS d S )Nr r )rG rZ r{ r )r" rw r r r __le__ s z Name.__le__c C s$ t |tr | j|d dkS tS d S )Nr r )rG rZ r{ r )r" rw r r r __ge__ s z Name.__ge__c C s$ t |tr | j|d dkS tS d S )Nr r )rG rZ r{ r )r" rw r r r __gt__ s z Name.__gt__c C s d| j d S )Nz <DNS name >)__str__)r" r r r __repr__ s z Name.__repr__c C s | j dS )NF)to_text)r" r r r r s z Name.__str__Fc C sp t | jdkrtdS t | jdkr:| jd dkr:tdS |rV| j rV| jdd }n| j}djtt|}|S ) zConvert name to text format. @param omit_final_dot: If True, don't emit the final dot (denoting the root label) for absolute names. The default is False. @rtype: string r @r r7 .N.rP )rQ rR r rk joinmapr0 )r" omit_final_dotrS sr r r r s z Name.to_textNc sx t | jdkrdS t | jdkr2| jd dkr2dS |rN| j rN| jdd }n| j} dkr`t dj fdd|D S ) a Convert name to Unicode text format. IDN ACE labels are converted to Unicode. @param omit_final_dot: If True, don't emit the final dot (denoting the root label) for absolute names. The default is False. @type omit_final_dot: bool @param idna_codec: IDNA encoder/decoder. If None, the IDNA_2003_Practical encoder/decoder is used. The IDNA_2003_Practical decoder does not impose any policy, it just decodes punycode, so if you don't want checking for compliance, you can use this decoder for IDNA2008 as well. @type idna_codec: dns.name.IDNA @rtype: string r @r r7 r Nc s g | ]} j |qS r )r. )r[ r\ ) idna_codecr r r] ) s z#Name.to_unicode.<locals>.<listcomp>rP )rQ rR rk IDNA_2003_Practicalr )r" r r rS r )r r to_unicode s zName.to_unicodec C sX | j s:|dks|j r tt| j}|jt|j n| j}dd |D }dj|S )a Convert name to a format suitable for digesting in hashes. The name is canonicalized and converted to uncompressed wire format. @param origin: If the name is relative and origin is not None, then origin will be appended to it. @type origin: dns.name.Name object @raises NeedAbsoluteNameOrOrigin: All names in wire format are absolute. If self is a relative name, then an origin must be supplied; if it is missing, then this exception is raised @rtype: string Nc S s* g | ]"}t jd t| t||j qS )z!B%ds)structpackrQ r$ )r[ r\ r r r r] @ s z&Name.to_digestable.<locals>.<listcomp>r7 )rk r listrR extendr )r" originrR Zdlabelsr r r to_digestable+ s zName.to_digestablec C s. |dkrt }d}nd}| j sR|dks2|j r6tt| j}|jt|j n| j}d}x|D ]}t||d }|d7 }|dk r|j|} nd} | dk rd| } tj d| } |j | P qb|dk rt |dkr|j } | dkr| ||< t |} |j tj d | | dkrb|j | qbW |r*|j S dS ) a Convert name to wire format, possibly compressing it. @param file: the file where the name is emitted (typically a BytesIO file). If None, a string containing the wire name will be returned. @type file: file or None @param compress: The compression table. If None (the default) names will not be compressed. @type compress: dict @param origin: If the name is relative and origin is not None, then origin will be appended to it. @type origin: dns.name.Name object @raises NeedAbsoluteNameOrOrigin: All names in wire format are absolute. If self is a relative name, then an origin must be supplied; if it is missing, then this exception is raised NTFr r i z!Hi? z!B)r rk r r rR r rZ getr r writerQ tellgetvalue) r" filecompressr Z want_returnrR rU r& nposrb r rS r r r to_wireD s@ z Name.to_wirec C s t | jS )z@The length of the name (in labels). @rtype: int )rQ rR )r" r r r __len__| s z Name.__len__c C s | j | S )N)rR )r" indexr r r __getitem__ s zName.__getitem__c C s | j |S )N) concatenate)r" rw r r r __add__ s z Name.__add__c C s | j |S )N) relativize)r" rw r r r __sub__ s z Name.__sub__c C sn t | j}|dkr | tjjfS ||kr2tjj| fS |dk sB||krJtdt| d| t| | d fS )a( Split a name into a prefix and suffix at depth. @param depth: the number of labels in the suffix @type depth: int @raises ValueError: the depth was not >= 0 and <= the length of the name. @returns: the tuple (prefix, suffix) @rtype: tuple r z0depth must be >= 0 and <= the length of the nameN)rQ rR dnsra emptyrX rZ )r" depthrS r r r split s z Name.splitc C s: | j rt|dkrtt| j}|jt|j t|S )zReturn a new name which is the concatenation of self and other. @rtype: dns.name.Name object @raises AbsoluteConcatenation: self is absolute and other is not the empty name r )rk rQ r r rR r rZ )r" rw rR r r r r s zName.concatenatec C s0 |dk r(| j |r(t| dt| S | S dS )zIf self is a subdomain of origin, return a new name which is self relative to origin. Otherwise return self. @rtype: dns.name.Name object N)r rZ rQ )r" r r r r r s zName.relativizec C s | j s| j|S | S dS )zIf self is a relative name, return a new name which is the concatenation of self and origin. Otherwise return self. @rtype: dns.name.Name object N)rk r )r" r r r r derelativize s zName.derelativizeTc C s& |r |r| j |S | j|S n| S dS )a Return a name with the relativity desired by the caller. If origin is None, then self is returned. Otherwise, if relativize is true the name is relativized, and if relativize is false the name is derelativized. @rtype: dns.name.Name object N)r r )r" r r r r r choose_relativity s zName.choose_relativityc C s& | t ks| tkrtt| jdd S )zReturn the parent of the name. @rtype: dns.name.Name object @raises NoParent: the name is either the root name or the empty name, and thus has no parent. r N)rootr r rZ rR )r" r r r parent s z Name.parent)F)FN)N)NNN)NT))r r r r __slots__r# r^ rc rg rh rj rk rm rq r{ r r r r r r r r r r r r r r r r r r r r r r r r r r; r r )r5 r rZ 7 sJ = 8 rZ r7 c C s t | tstd|dkp"t |ts,tdg }d}d}d}d}|dkrLt}| dkrXd} | rz| dkrptd gS x| D ]}|r|dkr|j rt|}|d 7 }q||7 }d}n@|j st|d 9 }|t|7 }|d 7 }|d krd}|t|7 }qv|dkr"t |dkr t |j |j | d}qv|dkr:d}d}d}qv||7 }qvW |rPtt |dkrp|j |j | n |j d t |dks|d d kr|dk r|j t|j t|S )a Convert unicode text into a Name object. Labels are encoded in IDN ACE form. @param text: The text to convert into a name. @type text: Unicode string @param origin: The origin to append to non-absolute names. @type origin: dns.name.Name @param idna_codec: IDNA encoder/decoder. If None, the default IDNA 2003 encoder/decoder is used. @type idna_codec: dns.name.IDNA @rtype: dns.name.Name object z0input to from_unicode() must be a unicode stringNz origin must be a Name or Noner6 Fr r r r7 r r 。 ． ｡rD T)r r r r rP )rG r rX rZ IDNA_2003isdigitrn r r rQ r appendr- r r rR ) rM r r rR r& escapingedigitsrT r* r r r from_unicode sd &r c C s t | trt| ||S t | ts(td|dkp8t |tsBtdg }d}d}d}d}| dkrbd} | r| dkrztdgS xt| D ]}tjd |} |r|dkr| j rt | }|d 7 }n || 7 }d}nF| j st |d 9 }|t | 7 }|d 7 }|d kr^d}|tjd |7 }q| dkr>t |dkr.t |j| d}q| d krVd}d}d}q|| 7 }qW |rlt t |dkr|j| n |jd t |dks|d dkr|dk r|jt|j t|S )a} Convert text into a Name object. @param text: The text to convert into a name. @type text: string @param origin: The origin to append to non-absolute names. @type origin: dns.name.Name @param idna_codec: IDNA encoder/decoder. If None, the default IDNA 2003 encoder/decoder is used. @type idna_codec: dns.name.IDNA @rtype: dns.name.Name object z%input to from_text() must be a stringNz origin must be a Name or Noner7 Fr r r z!Br r r \TrP )rG r r r rX rZ rI r r r rn r rQ r r r r rR ) rM r r rR r& r r rT r* Zbyte_r r r from_text* sf &r c C s t | tstdtjj| } g }|}d}| | }|d7 }d}x|dkr|dk r|j| ||| j ||7 }|dkr||7 }nJ|dkr|d@ d | | }|dkr|d7 }||krt|}|d7 }nt | | }|d7 }|dkr@|d7 }q@W |jd t ||fS ) a^ Convert possibly compressed wire format into a Name. @param message: the entire DNS message @type message: string @param current: the offset of the beginning of the name from the start of the message @type current: int @raises dns.name.BadPointer: a compression pointer did not point backwards in the message @raises dns.name.BadLabelType: an invalid label type was encountered. @returns: a tuple consisting of the name that was read and the number of bytes of the wire format message which were consumed reading it @rtype: (dns.name.Name object, int) tuple z*input to from_wire() must be a byte stringr r @ rN r6 ) rG r rX r ZwiredataZ maybe_wrapr Zunwrapr r rZ )messageZcurrentrR Zbiggest_pointerZhopscountZcusedr r r from_wirep s< r )Cr ior r sysrd Zencodings.idnar8 r9 rA ImportErrorZ dns.exceptionr Z dns.wiredataZ_compatr r r r r ro AttributeErrorcalcsizerr rt ru rv rs Z exception SyntaxErrorr r Z FormErrorr r Z DNSExceptionr r r r r r r objectr! r2 r< rI rJ rL r ZIDNA_2003_Strictr ZIDNA_2008_PracticalZIDNA_2008_UTS_46ZIDNA_2008_StrictZIDNA_2008_TransitionalZ IDNA_2008r0 rW rY rZ r r r r r r r r r <module> st > * HFPK g\Yҹu u % __pycache__/zone.cpython-36.opt-1.pycnu [ 3 ӕWZ @ sN d Z ddlmZ ddlZddlZddlZddlmZ ddlZ ddl Z ddl Z ddl Z ddl Z ddlZ ddlZ ddlZ ddlZ ddlZ ddlmZmZ ejd kZG dd d e jjZG d d d eZG d d d eZ G dd deZ G dd de Z G dd de Z de j!j"de dddfddZ#de j!j"de dddfddZ$e ddfddZ%dS ) z DNS Zones. ) generatorsN)BytesIO ) string_types text_type c @ s e Zd ZdZdS )BadZonezThe DNS zone is malformed.N)__name__ __module__ __qualname____doc__ r r /usr/lib/python3.6/zone.pyr ) s r c @ s e Zd ZdZdS )NoSOAz)The DNS zone has no SOA RR at its origin.N)r r r r r r r r r . s r c @ s e Zd ZdZdS )NoNSz+The DNS zone has no NS RRset at its origin.N)r r r r r r r r r 3 s r c @ s e Zd ZdZdS ) UnknownOriginz!The DNS zone's origin is unknown.N)r r r r r r r r r 8 s r c @ sj e Zd ZdZejjZddddgZej j dfddZ d d Z d d Z d d Zdd Zdd Zdd Zdd Zdd Zdd Zdd Zd d Zd d ZeZd!d" Zd#d$ ZdCd&d'ZdDd(d)Z d*d+ Z ej j d%fd,d-Z ej j d%fd.d/Z!ej j fd0d1Z"d2d3 Z#ej j fd4d5Z$ej j fd6d7Z%ej j&ej j fd8d9Z'ej j&ej j fd:d;Z(dEd=d>Z)dFd?d@Z*dAdB Z+d<S )GZoneaZ A DNS zone. A Zone is a mapping from names to nodes. The zone object may be treated like a Python dictionary, e.g. zone[name] will retrieve the node associated with that name. The I{name} may be a dns.name.Name object, or it may be a string. In the either case, if the name is relative it is treated as relative to the origin of the zone. @ivar rdclass: The zone's rdata class; the default is class IN. @type rdclass: int @ivar origin: The origin of the zone. @type origin: dns.name.Name object @ivar nodes: A dictionary mapping the names of nodes in the zone to the nodes themselves. @type nodes: dict @ivar relativize: should names in the zone be relativized? @type relativize: bool @cvar node_factory: the factory used to create a new node @type node_factory: class or callable rdclassoriginnodes relativizeTc C sb |dk rFt |tr tjj|}nt |tjjs6td|j sFtd|| _|| _ i | _ || _ dS )zInitialize a zone object. @param origin: The origin of the zone. @type origin: dns.name.Name object @param rdclass: The zone's rdata class; the default is class IN. @type rdclass: intNz2origin parameter must be convertible to a DNS namez)origin parameter must be an absolute name) isinstancer dnsname from_textName ValueError is_absoluter r r r )selfr r r r r r __init__Y s z Zone.__init__c C s: t |tsdS | j|jks2| j|jks2| j|jkr6dS dS )ziTwo zones are equal if they have the same origin, class, and nodes. @rtype: bool FT)r r r r r )r otherr r r __eq__n s z Zone.__eq__c C s | j | S )z6Are two zones not equal? @rtype: bool )r! )r r r r r __ne__| s z Zone.__ne__c C sb t |trtjj|d }nt |tjjs0td|j r^|j| j sLtd| j r^|j | j }|S )Nz0name parameter must be convertible to a DNS namez5name parameter must be a subdomain of the zone origin) r r r r r r KeyErrorr is_subdomainr r )r r r r r _validate_name s zZone._validate_namec C s | j |}| j| S )N)r% r )r keyr r r __getitem__ s zZone.__getitem__c C s | j |}|| j|< d S )N)r% r )r r& valuer r r __setitem__ s zZone.__setitem__c C s | j |}| j|= d S )N)r% r )r r& r r r __delitem__ s zZone.__delitem__c C s | j j S )N)r __iter__)r r r r r+ s z Zone.__iter__c C s t r| jj S | jj S d S )N)_py3r keysiterkeys)r r r r r. s z Zone.iterkeysc C s | j j S )N)r r- )r r r r r- s z Zone.keysc C s t r| jj S | jj S d S )N)r, r values itervalues)r r r r r0 s zZone.itervaluesc C s | j j S )N)r r/ )r r r r r/ s z Zone.valuesc C s | j j S )N)r items)r r r r r1 s z Zone.itemsc C s | j |}| jj|S )N)r% r get)r r& r r r r2 s zZone.getc C s || j kS )N)r )r r r r r __contains__ s zZone.__contains__Fc C s< | j |}| jj|}|dkr8|s&t| j }|| j|< |S )ar Find a node in the zone, possibly creating it. @param name: the name of the node to find @type name: dns.name.Name object or string @param create: should the node be created if it doesn't exist? @type create: bool @raises KeyError: the name is not known and create was not specified. @rtype: dns.node.Node object N)r% r r2 r# node_factory)r r createnoder r r find_node s zZone.find_nodec C s. y| j ||}W n tk r( d}Y nX |S )a Get a node in the zone, possibly creating it. This method is like L{find_node}, except it returns None instead of raising an exception if the node does not exist and creation has not been requested. @param name: the name of the node to find @type name: dns.name.Name object or string @param create: should the node be created if it doesn't exist? @type create: bool @rtype: dns.node.Node object or None N)r7 r# )r r r5 r6 r r r get_node s z Zone.get_nodec C s | j |}|| jkr | j|= dS )zhDelete the specified node if it exists. It is not an error if the node does not exist. N)r% r )r r r r r delete_node s zZone.delete_nodec C sT | j |}t|tr tjj|}t|tr6tjj|}| j||}|j| j|||S )a Look for rdata with the specified name and type in the zone, and return an rdataset encapsulating it. The I{name}, I{rdtype}, and I{covers} parameters may be strings, in which case they will be converted to their proper type. The rdataset returned is not a copy; changes to it will change the zone. KeyError is raised if the name or type are not found. Use L{get_rdataset} if you want to have None returned instead. @param name: the owner name to look for @type name: DNS.name.Name object or string @param rdtype: the rdata type desired @type rdtype: int or string @param covers: the covered type (defaults to None) @type covers: int or string @param create: should the node and rdataset be created if they do not exist? @type create: bool @raises KeyError: the node or rdata could not be found @rtype: dns.rrset.RRset object ) r% r r r rdatatyper r7 find_rdatasetr )r r rdtypecoversr5 r6 r r r r; s zZone.find_rdatasetc C s2 y| j ||||}W n tk r, d}Y nX |S )a Look for rdata with the specified name and type in the zone, and return an rdataset encapsulating it. The I{name}, I{rdtype}, and I{covers} parameters may be strings, in which case they will be converted to their proper type. The rdataset returned is not a copy; changes to it will change the zone. None is returned if the name or type are not found. Use L{find_rdataset} if you want to have KeyError raised instead. @param name: the owner name to look for @type name: DNS.name.Name object or string @param rdtype: the rdata type desired @type rdtype: int or string @param covers: the covered type (defaults to None) @type covers: int or string @param create: should the node and rdataset be created if they do not exist? @type create: bool @rtype: dns.rrset.RRset object N)r; r# )r r r< r= r5 rdatasetr r r get_rdataset s zZone.get_rdatasetc C sr | j |}t|tr tjj|}t|tr6tjj|}| j|}|dk rn|j| j|| t |dkrn| j | dS )a Delete the rdataset matching I{rdtype} and I{covers}, if it exists at the node specified by I{name}. The I{name}, I{rdtype}, and I{covers} parameters may be strings, in which case they will be converted to their proper type. It is not an error if the node does not exist, or if there is no matching rdataset at the node. If the node has no rdatasets after the deletion, it will itself be deleted. @param name: the owner name to look for @type name: DNS.name.Name object or string @param rdtype: the rdata type desired @type rdtype: int or string @param covers: the covered type (defaults to None) @type covers: int or string Nr ) r% r r r r: r r8 delete_rdatasetr lenr9 )r r r< r= r6 r r r r@ 4 s zZone.delete_rdatasetc C s. |j | j krtd| j|d}|j| dS )a: Replace an rdataset at name. It is not an error if there is no rdataset matching I{replacement}. Ownership of the I{replacement} object is transferred to the zone; in other words, this method does not store a copy of I{replacement} at the node, it stores I{replacement} itself. If the I{name} node does not exist, it is created. @param name: the owner name @type name: DNS.name.Name object or string @param replacement: the replacement rdataset @type replacement: dns.rdataset.Rdataset z#replacement.rdclass != zone.rdclassTN)r r r7 replace_rdataset)r r Z replacementr6 r r r rB U s zZone.replace_rdatasetc C sn | j |}t|tr tjj|}t|tr6tjj|}| j| j| j||}tj j || j||}|j | |S )a Look for rdata with the specified name and type in the zone, and return an RRset encapsulating it. The I{name}, I{rdtype}, and I{covers} parameters may be strings, in which case they will be converted to their proper type. This method is less efficient than the similar L{find_rdataset} because it creates an RRset instead of returning the matching rdataset. It may be more convenient for some uses since it returns an object which binds the owner name to the rdata. This method may not be used to create new nodes or rdatasets; use L{find_rdataset} instead. KeyError is raised if the name or type are not found. Use L{get_rrset} if you want to have None returned instead. @param name: the owner name to look for @type name: DNS.name.Name object or string @param rdtype: the rdata type desired @type rdtype: int or string @param covers: the covered type (defaults to None) @type covers: int or string @raises KeyError: the node or rdata could not be found @rtype: dns.rrset.RRset object ) r% r r r r: r r r; r rrsetZRRsetupdate)r r r< r= r> rC r r r find_rrsetk s zZone.find_rrsetc C s0 y| j |||}W n tk r* d}Y nX |S )aJ Look for rdata with the specified name and type in the zone, and return an RRset encapsulating it. The I{name}, I{rdtype}, and I{covers} parameters may be strings, in which case they will be converted to their proper type. This method is less efficient than the similar L{get_rdataset} because it creates an RRset instead of returning the matching rdataset. It may be more convenient for some uses since it returns an object which binds the owner name to the rdata. This method may not be used to create new nodes or rdatasets; use L{find_rdataset} instead. None is returned if the name or type are not found. Use L{find_rrset} if you want to have KeyError raised instead. @param name: the owner name to look for @type name: DNS.name.Name object or string @param rdtype: the rdata type desired @type rdtype: int or string @param covers: the covered type (defaults to None) @type covers: int or string @rtype: dns.rrset.RRset object N)rE r# )r r r< r= rC r r r get_rrset s zZone.get_rrsetc c s~ t |trtjj|}t |tr,tjj|}xL| j D ]@\}}x6|D ].}|tjjksh|j|krD|j|krD||fV qDW q6W dS )a Return a generator which yields (name, rdataset) tuples for all rdatasets in the zone which have the specified I{rdtype} and I{covers}. If I{rdtype} is dns.rdatatype.ANY, the default, then all rdatasets will be matched. @param rdtype: int or string @type rdtype: int or string @param covers: the covered type (defaults to None) @type covers: int or string N) r r r r: r iteritemsANYr< r= )r r< r= r r6 rdsr r r iterate_rdatasets s zZone.iterate_rdatasetsc c s t |trtjj|}t |tr,tjj|}x^| j D ]R\}}xH|D ]@}|tjjksh|j|krD|j|krDx|D ]}||j |fV qnW qDW q6W dS )a Return a generator which yields (name, ttl, rdata) tuples for all rdatas in the zone which have the specified I{rdtype} and I{covers}. If I{rdtype} is dns.rdatatype.ANY, the default, then all rdatas will be matched. @param rdtype: int or string @type rdtype: int or string @param covers: the covered type (defaults to None) @type covers: int or string N) r r r r: r rG rH r< r= ttl)r r< r= r r6 rI rdatar r r iterate_rdatas s zZone.iterate_rdatasNc C s8 t |trt|d}d}nd}t|dd}|dkr6d}|dkrPtjj|}d}n"t |trf|j|}n |}|j }z|rt| j }|j n| j }x|D ]} | | j | | j |d} t | tr| j|} n | } | j } y|j| |j| W q tk r |j| |j| Y qX qW W d|r2|j X dS ) a Write a zone to a file. @param f: file or string. If I{f} is a string, it is treated as the name of a file to open. @param sorted: if True, the file will be written with the names sorted in DNSSEC order from least to greatest. Otherwise the names will be written in whatever order they happen to have in the zone's dictionary. @param relativize: if True, domain names in the output will be relativized to the zone's origin (if possible). @type relativize: bool @param nl: The end of line string. If not specified, the output will use the platform's native end-of-line marker (i.e. LF on POSIX, CRLF on Windows, CR on Macintosh). @type nl: string or None wbTFencodingNzutf-8 )r r )r r opengetattroslinesepencodedecodelistr- sortr. to_textr r write TypeErrorclose) r fsortedr nl want_closeZfile_encZnl_bnamesnlZl_br r r to_file sD z Zone.to_filec C s* t }| j|||| |j }|j |S )a Return a zone's text as though it were written to a file. @param sorted: if True, the file will be written with the names sorted in DNSSEC order from least to greatest. Otherwise the names will be written in whatever order they happen to have in the zone's dictionary. @param relativize: if True, domain names in the output will be relativized to the zone's origin (if possible). @type relativize: bool @param nl: The end of line string. If not specified, the output will use the platform's native end-of-line marker (i.e. LF on POSIX, CRLF on Windows, CR on Macintosh). @type nl: string or None )r rd getvaluer\ )r r^ r r_ Z temp_bufferZ return_valuer r r rY $ s z Zone.to_textc C sJ | j rtjj}n| j}| j|tjjdkr.t| j|tjj dkrFt dS )zDo some simple checking of the zone's origin. @raises dns.zone.NoSOA: there is no SOA RR @raises dns.zone.NoNS: there is no NS RRset @raises KeyError: there is no origin node N) r r r emptyr r? r: ZSOAr ZNSr )r r r r r check_origin9 s zZone.check_origin)F)F)TTN)TTN),r r r r r r6 ZNoder4 __slots__ rdataclassINr r! r" r% r' r) r* r+ r. r- r0 r/ r1 rG r2 r3 r7 r8 r9 r: ZNONEr; r? r@ rB rE rF rH rJ rM rd rY rg r r r r r = sJ # !(" @ r c @ sH e Zd ZdZeddfddZdd Zdd Zd d Zd d Z dd Z dS ) _MasterReadera Read a DNS master file @ivar tok: The tokenizer @type tok: dns.tokenizer.Tokenizer object @ivar ttl: The default TTL @type ttl: int @ivar last_name: The last name read @type last_name: dns.name.Name object @ivar current_origin: The current origin @type current_origin: dns.name.Name object @ivar relativize: should names in the zone be relativized? @type relativize: bool @ivar zone: the zone @type zone: dns.zone.Zone object @ivar saved_state: saved reader state (used when processing $INCLUDE) @type saved_state: list of (tokenizer, current_origin, last_name, file) tuples. @ivar current_file: the file object of the $INCLUDed file being parsed (None if no $INCLUDE is active). @ivar allow_include: is $INCLUDE allowed? @type allow_include: bool @ivar check_origin: should sanity checks of the origin node be done? The default is True. @type check_origin: bool FTc C sb t |trtjj|}|| _|| _|| _d| _| j| _ ||||d| _ g | _ d | _ || _ || _d S )Nr )r )r r r r r tokcurrent_originr rK last_namezone saved_state current_file allow_includerg )r rl r r r zone_factoryrr rg r r r r f s z_MasterReader.__init__c C s x| j j }|j rP qW d S )N)rl r2 is_eol_or_eof)r tokenr r r _eat_lineu s z_MasterReader._eat_linec " C s | j dkrt| jjdd}|j s:tjj|j| j | _ n"| jj }|j rPdS | jj | | j }|j | j js|| j dS | jr|j| j j}| jj }|j stjjy,tjj|j}| jj }|j stjjW n tjjk r | j}Y nX y.tjj|j}| jj }|j s"tjjW n> tjjk rF tjjY n tk rb | j j}Y nX || j jkr~tjjdytjj|j}W n tjjd|j Y nX | j jj|}|dkr| j j }|| j j|< y tj j||| j| j d}W nl tjjk r, t j dd \}} | Y n< t j dd \}} tjjdt |t | f Y nX |j | j j| j |j! } |j"||| d} | j#|| dS ) z(Process one line from a DNS master file.NT)Z want_leadingz RR class is not zone's classzunknown rdatatype '%s'F zcaught exception %s: %s)$rm r rl r2 Z is_whitespacer r r r( rn rt ungetr$ ro r rv r is_identifier exception SyntaxErrorrK BadTTLri Exceptionr r: r r4 rL sysexc_infostrchoose_relativityr= r; add) r ru r rK r r< rb rdtyvar= rI r r r _rr_line{ sx z_MasterReader._rr_linec C s t jd}t jd}t jd}|j|}|rJ|j \}}}} } |dkrJd}|j|} | rz| j \}}}|dkrrd}d} d} |j|} | r|j \}}}} |dkrd}|j d } d} |p| p| sd}d}d}d} d} | dkrt |||| | fS ) Nz"^.*\$({(\+|-?)(\d+),(\d+),(.)}).*$z^.*\$({(\+|-?)(\d+)}).*$z ^.*\$({(\+|-?)(\d+),(\d+)}).*$ +r drw )recompilematchgroupsNotImplementedError) r ZsideZ is_generate1Z is_generate2Z is_generate3Zg1modZsignoffsetwidthbaseZg2Zg3r r r _parse_modify s> z_MasterReader._parse_modifyc ! 7 C s | j dkrt| jj }y2tjj|j\}}}| jj }|j sHtj j W n tj j Y nX y$|j}| jj }|j stj j W n tj j Y nX y,tj j|j}| jj }|j stj j W n tj j k r | j }Y nX y.tj j|j}| jj }|j stj j W n> tj j k r6 tj j Y n tk rR | jj}Y nX || jjkrntj j dy.tjj|j}| jj }|j stj j W n( tk r tj j d|j Y nX y |j} W n tj j Y nX | j|\} } } } }| j| \}}}}}xt||d |D ]}| dkr@|t| }n| dkrV|t| }|dkrn|t| }n|dkr|t| }t|jt| }t|jt|}|jd| |}| jd| |}tjj|| j | _| j}|j| jjs| j dS | j r|j | jj}| jj j|}|dkr@| jj }|| jj |< ytj j|||| j d} W nl tj j k r t!j" dd \} } | Y n< t!j" dd \} } tj j d t| t| f Y nX | j#| jj| j | j$ } |j%||| d } | j&| | q"W dS ) zRProcess one line containing the GENERATE statement from a DNS master file.Nz RR class is not zone's classzunknown rdatatype '%s'r r -z$%sFrw zcaught exception %s: %sT)'rm r rl r2 r Zgranger r( ry rz r{ rK r| ri r} ro r r: r rangeintr zfillreplacer rn r$ r rv r r r4 rL r~ r r r= r; r )!r ru startstopstepZlhsrK r r< ZrhsZlmodZlsignZloffsetZlwidthZlbaseZrmodZrsignZroffsetZrwidthZrbaseiZlindexrindexZlzfindexZrzfindexr rL rb r r r r= rI r r r _generate_line s z _MasterReader._generate_linec C s y x| j jdd}|j rh| jdk r2| jj t| jdkrb| jjd\| _ | _| _ | _| _ qP n|j rvqn|j r| j j qnx|jd dkr|jj }|dkr| j j }|j stjjdtj j|j| _ | j j q|dkr$| j j | _| j j | jjdkr| j| j_q|d kr| jr| j j }|j}| j j }|j rxtjj|j| j}| j j n |j stjjd n| j}| jj| j | j| j | j| j f t |d | _tj j | j|| _ || _q|d kr| j qtjjd | d q| j j | | j! qW W nZ tjjk rz } z8| j j" \}}|dkrTd}tjjd|||f W Y dd}~X nX | j#r| jj# dS )zRead a DNS master file and build a zone object. @raises dns.zone.NoSOA: No SOA RR was found at the zone origin @raises dns.zone.NoNS: No NS RRset was found at the zone origin TNr r $z$TTLzbad $TTLz$ORIGINz$INCLUDEzbad origin in $INCLUDErz $GENERATEz Unknown master file directive ''z syntax errorz %s:%d: %s)$rl r2 Zis_eofrq r\ rA rp poprm rn rK Zis_eolZ is_commentZget_eolr( upperry r rz r{ r Zget_namero r rr r rt appendrQ tokenizer Tokenizerr rx r whererg )r ru cfilenameZ new_originZdetailZ line_numberr r r reade s "z_MasterReader.readN) r r r r r r rv r r r r r r r r rk J s L)urk TFc C s> |dkr d}t jj| |}t|||||||d} | j | jS )ar Build a zone object from a master file format string. @param text: the master file format input @type text: string. @param origin: The origin of the zone; if not specified, the first $ORIGIN statement in the master file will determine the origin of the zone. @type origin: dns.name.Name object or string @param rdclass: The zone's rdata class; the default is class IN. @type rdclass: int @param relativize: should names be relativized? The default is True @type relativize: bool @param zone_factory: The zone factory to use @type zone_factory: function returning a Zone @param filename: The filename to emit when describing where an error occurred; the default is '<string>'. @type filename: string @param allow_include: is $INCLUDE allowed? @type allow_include: bool @param check_origin: should sanity checks of the origin node be done? The default is True. @type check_origin: bool @raises dns.zone.NoSOA: No SOA RR was found at the zone origin @raises dns.zone.NoNS: No NS RRset was found at the zone origin @rtype: dns.zone.Zone object Nz<string>)rr rg )r r r rk r ro ) textr r r rs r rr rg rl readerr r r r s " r c C sl t }d} t| |r.|dkr | }t| | } d} n|dkr:d}d} zt| |||||||} W d| rf| j X | S )a Read a master file and build a zone object. @param f: file or string. If I{f} is a string, it is treated as the name of a file to open. @param origin: The origin of the zone; if not specified, the first $ORIGIN statement in the master file will determine the origin of the zone. @type origin: dns.name.Name object or string @param rdclass: The zone's rdata class; the default is class IN. @type rdclass: int @param relativize: should names be relativized? The default is True @type relativize: bool @param zone_factory: The zone factory to use @type zone_factory: function returning a Zone @param filename: The filename to emit when describing where an error occurred; the default is '<file>', or the value of I{f} if I{f} is a string. @type filename: string @param allow_include: is $INCLUDE allowed? @type allow_include: bool @param check_origin: should sanity checks of the origin node be done? The default is True. @type check_origin: bool @raises dns.zone.NoSOA: No SOA RR was found at the zone origin @raises dns.zone.NoNS: No NS RRset was found at the zone origin @rtype: dns.zone.Zone object ZrUNTz<file>F)r r rQ r r\ ) r] r r r rs r rr rg Zstr_typeZoptsr` zr r r from_file s r c C s d}x| D ]}|dkrH|r"|j }n |jd j}|jd j}||||d}x||jD ]r}|jj|j} | sz|j } | |j|j< | j|j|j|j d} | j |j x$|D ] } | j |j | | j | qW qPW q W |r|j |S )a Convert the output of a zone transfer generator into a zone object. @param xfr: The xfr generator @type xfr: generator of dns.message.Message objects @param relativize: should names be relativized? The default is True. It is essential that the relativize setting matches the one specified to dns.query.xfr(). @type relativize: bool @param check_origin: should sanity checks of the origin node be done? The default is True. @type check_origin: bool @raises dns.zone.NoSOA: No SOA RR was found at the zone origin @raises dns.zone.NoNS: No NS RRset was found at the zone origin @rtype: dns.zone.Zone object Nr )r T)r Zanswerr r r r2 r4 r; r< r= Z update_ttlrK r r rg ) Zxfrrs r rg r r r r rC ZznodeZzrdsr r r r from_xfr s, r )r )&r Z __future__r r~ r rS ior Z dns.exceptionr Zdns.nameZdns.nodeZdns.rdataclassZ dns.rdatatypeZ dns.rdataZ dns.rrsetZ dns.tokenizerZdns.ttlZ dns.grangeZ_compatr r version_infor, rz Z DNSExceptionr r r r objectr rk ri rj r r r r r r r <module> sH o*3PK g\Z ! __pycache__/grange.cpython-36.pycnu [ 3 bW @ s d Z ddlZdd ZdS )z DNS GENERATE range conversion. Nc C s d}d}d}| r(| d dkr(t jjdxj| D ]b}|dkrT|dkrTt|}d}d}q.|dkrnt|}d}d}q.|j r||7 }q.t jjd | q.W |d krt jj |dkrt|}|dkrt|}|dkst|dkst||kst|||fS ) zConvert the text form of a range in a GENERATE statement to an integer. @param text: the textual range @type text: string @return: The start, stop and step values. @rtype: tuple r -z!Start cannot be a negative number / zCould not parse %s )r r )dnsZ exception SyntaxErrorintisdigitAssertionError)textstepZcurstatecstartstop r /usr/lib/python3.6/grange.py from_text s6 r )__doc__r r r r r r <module> s PK g\d rN N __pycache__/ipv4.cpython-36.pycnu [ 3 bW @ s4 d Z ddlZddlZddlmZ dd Zdd ZdS ) zIPv4 helper functions. N ) binary_typec C sJ t | dkrtjjt| ts&t| } d| d | d | d | d f j S )zConvert an IPv4 address in network form to text form. @param address: The IPv4 address @type address: string @returns: string z %u.%u.%u.%ur r )lendns exception SyntaxError isinstance bytearrayencode)Zaddress r /usr/lib/python3.6/ipv4.py inet_ntoa s r c C s t | ts| j } | jd}t|dkr0tjjx<|D ]4}|j sJtjjt|dkr6|d dkr6tjjq6W y dd |D }t j d | S tjjY nX d S ) zConvert an IPv4 address in text form to network form. @param text: The IPv4 address @type text: string @returns: string .r r r 0c S s g | ] }t |qS r )int).0partr r r <listcomp>8 s z inet_aton.<locals>.<listcomp>BBBBN)r ) r r r splitr r r r isdigitstructpack)textpartsr bytesr r r inet_aton% s r )__doc__r Z dns.exceptionr Z_compatr r r r r r r <module> s PK g\JaA A __pycache__/tsig.cpython-36.pycnu [ 3 bW& @ s~ d Z ddlZddlZddlZddlZddlZddlZddlm Z m Z m Z G dd dej j ZG dd dej j ZG d d d ej j ZG d d d eZG d d deZG dd deZG dd deZejjdZejjdZejjdZejjdZejjdZejjdZ ededede d ed ed iZ eZ d Z d Z d!Z!d"Z"dd#d$e fd%d&Z#dd#d$e fd'd(Z$d/d)d*Z%d+d, Z&d-d. Z'dS )0zDNS TSIG support. N )long string_types text_typec @ s e Zd ZdZdS )BadTimez8The current time is not within the TSIG's validity time.N)__name__ __module__ __qualname____doc__ r r /usr/lib/python3.6/tsig.pyr s r c @ s e Zd ZdZdS ) BadSignaturez#The TSIG signature fails to verify.N)r r r r r r r r r s r c @ s e Zd ZdZdS ) PeerErrorz;Base class for all TSIG errors generated by the remote peerN)r r r r r r r r r % s r c @ s e Zd ZdZdS ) PeerBadKeyz$The peer didn't know the key we usedN)r r r r r r r r r * s r c @ s e Zd ZdZdS )PeerBadSignaturez*The peer didn't like the signature we sentN)r r r r r r r r r / s r c @ s e Zd ZdZdS ) PeerBadTimez%The peer didn't like the time we sentN)r r r r r r r r r 4 s r c @ s e Zd ZdZdS )PeerBadTruncationz=The peer didn't like amount of truncation in the TSIG we sentN)r r r r r r r r r 9 s r zHMAC-MD5.SIG-ALG.REG.INTz hmac-sha1z hmac-sha224z hmac-sha256z hmac-sha384z hmac-sha512ZSHA224ZSHA256ZSHA384ZSHA512ZSHA1ZMD5 FTc C s t |tr|j }t| \} }| r\tj||d} t|}|dkr\| jtj d| | j| tj d|}| j| | j| dd | r| j|j | jtj dt j j | jtj dd |td }|d? td@ }|td @ }tj d |||}| | }t|}|dkrtd tj d ||| }| rF| j| | j| n | j| | j }tj dt|}|| | | | }| rtj||d} t|}| jtj d| | j| nd} ||| fS ) aj Return a (tsig_rdata, mac, ctx) tuple containing the HMAC TSIG rdata for the input parameters, the HMAC MAC calculated by applying the TSIG signature algorithm, and the TSIG digest context. @rtype: (string, string, hmac.HMAC object) @raises ValueError: I{other_data} is too long @raises NotImplementedError: I{algorithm} is not supported ) digestmodr z!H Nz!I i l z!HIHz TSIG Other Data is > 65535 bytesz!HH) isinstancer encode get_algorithmhmacnewlenupdatestructpack to_digestablednsZ rdataclassANYr ValueErrorZdigest)wirekeynamesecrettimefudge original_iderror other_data request_macctxmultifirst algorithmZalgorithm_namer ZmlidZ long_time upper_time lower_timeZtime_macZpre_macZolZpost_macmacZmpack tsig_rdatar r r signW sN r9 c C s t | ||||||||| | | | S )N)r9 ) r' r( r) r* r+ r, r- r. r/ r0 r1 r2 r3 r r r hmac_md5 s r: c C s t jd| dd \} | dkr&tjj| d8 } | dd t jd| | d| } |} tjj| | \}}| | } t jd| | | d \}}}}|td d> |td }| d7 } | | | | }| |7 } t jd| | | d \}}}| d 7 } | | | | }| |7 } | || kr tjj|dkrv|t kr:t n<|t krJt n,|t krZtn |tkrjtn td | || }|| }||k s||krtt| |||||||||| | | \} } }| |krt|S ) a* Validate the specified TSIG rdata against the other input parameters. @raises FormError: The TSIG is badly formed. @raises BadTime: There is too much time skew between the client and the server. @raises BadSignature: The TSIG signature did not validate @rtype: hmac.HMAC objectz!H r r z!HIHHr z!HHH zunknown TSIG error code %d)r! unpackr$ exception FormErrorr" name from_wirer BADSIGr BADKEYr BADTIMEr BADTRUNCr r r r9 r ) r' r( r) Znowr/ Z tsig_startr8 tsig_rdlenr0 r1 r2 ZadcountZnew_wirecurrentanameusedr5 r6 r+ mac_sizer* r7 r, r- Z other_sizer. Ztime_lowZ time_highZjunkZour_macr r r validate sN $ rL c C s\ t | trtjj| } y| j tjjt| fS t k rV t dt | d Y nX dS )zReturns the wire format string and the hash module to use for the specified TSIG algorithm @rtype: (string, hash constructor) @raises NotImplementedError: I{algorithm} is not supported zTSIG algorithm z is not supportedN) r r r$ rA from_textr# hashZhashes_hashesKeyErrorNotImplementedErrorstr)r3 r r r r s r c C sz |}t jj| |\}}|| }tjd| ||d \}}}} |d7 }| ||| } || 7 }||| krrt jj|| fS )zlReturn the tsig algorithm for the specified tsig_rdata @raises FormError: The TSIG is badly formed. z!HIHHr; )r$ rA rB r! r> r? r@ ) r' r8 rG rH rI rJ r5 r6 r+ rK r7 r r r get_algorithm_and_mac s rS )NFT)(r r r! Z dns.exceptionr$ Zdns.hashZdns.rdataclassZdns.nameZ_compatr r r r? Z DNSExceptionr r r r r r r rA rM ZHMAC_MD5Z HMAC_SHA1Z HMAC_SHA224Z HMAC_SHA256Z HMAC_SHA384Z HMAC_SHA512rO Zdefault_algorithmrC rD rE rF r9 r: rL r rS r r r r <module> sL 5 5PK g\])z z __pycache__/flags.cpython-36.pycnu [ 3 bWh @ s d Z dZdZdZdZdZdZdZdZeeeeeeedZ d eiZ e d d e j D Z e d d e j D Zd d Zee ZeeZdd Zdd Zdd Zdd Zdd Zdd ZdS ) zDNS Message Flags.i i i )QRAATCRDRAADCDDOc c s | ]\}}||fV qd S )N ).0xyr r /usr/lib/python3.6/flags.py <genexpr>3 s r c c s | ]\}}||fV qd S )Nr )r r r r r r r 5 s c C s t | j }|j |j |S )N)listitemssortreverse)tableorderr r r _order_flags8 s r c C s. d}| j }x |D ]}|||j B }qW |S )N )splitupper)textr flagstokenstr r r _from_textC s r! c C s6 g }x&|D ] \}}| |@ dkr |j | q W dj|S )Nr )appendjoin)r r r Z text_flagskvr r r _to_textK s r' c C s t | tS )zZConvert a space-separated list of flag text values into a flags value. @rtype: int)r! _by_text)r r r r from_textS s r) c C s t | ttS )z]Convert a flags value into a space-separated list of flag text values. @rtype: string)r' _by_value _flags_order)r r r r to_text[ s r, c C s t | tS )zdConvert a space-separated list of EDNS flag text values into a EDNS flags value. @rtype: int)r! _edns_by_text)r r r r edns_from_textc s r. c C s t | ttS )zhConvert an EDNS flags value into a space-separated list of EDNS flag text values. @rtype: string)r' _edns_by_value_edns_flags_order)r r r r edns_to_textk s r1 N)__doc__r r r r r r r r r( r- dictr r* r/ r r+ r0 r! r' r) r, r. r1 r r r r <module> s6 PK g\{_ $ __pycache__/set.cpython-36.opt-1.pycnu [ 3 bW# @ s d Z G dd deZdS )zA simple Set class.c @ s e Zd ZdZdgZdDddZdd Zdd Zd d Zd d Z dd Z dd Z dd Z dd Z dd Zdd Zdd Zd d Zd d Zd d! Zd"d# Zd$d% Zd&d' Zd(d) Zd*d+ Zd,d- Zd.d/ Zd0d1 Zd2d3 Z d4d5 Z d6d7 Z d8d9 Z d:d; Z d<d= Z!d>d? Z"d@dA Z#dBdC Z$dS )ESeta' A simple set class. Sets are not in Python until 2.3, and rdata are not immutable so we cannot use sets.Set anyway. This class implements subset of the 2.3 Set interface using a list as the container. @ivar items: A list of the items which are in the set @type items: listitemsNc C s* g | _ |dk r&x|D ]}| j| qW dS )zvInitialize the set. @param items: the initial set of items @type items: any iterable or None N)r add)selfr item r /usr/lib/python3.6/set.py__init__ s z Set.__init__c C s dt | j S )Nzdns.simpleset.Set(%s))reprr )r r r r __repr__, s z Set.__repr__c C s || j kr| j j| dS )zAdd an item to the set.N)r append)r r r r r r / s zSet.addc C s | j j| dS )z Remove an item from the set.N)r remove)r r r r r r 4 s z Set.removec C s* y| j j| W n tk r$ Y nX dS )z'Remove an item from the set if present.N)r r ValueError)r r r r r discard8 s z Set.discardc C s | j }|j|}t| j|_|S )a Make a (shallow) copy of the set. There is a 'clone protocol' that subclasses of this class should use. To make a copy, first call your super's _clone() method, and use the object returned as the new instance. Then make shallow copies of the attributes defined in the subclass. This protocol allows us to write the set algorithms that return new instances (e.g. union) once, and keep using them in subclasses. ) __class____new__listr )r clsobjr r r _clone? s z Set._clonec C s | j S )z!Make a (shallow) copy of the set.)r )r r r r __copy__Q s z Set.__copy__c C s | j S )z!Make a (shallow) copy of the set.)r )r r r r copyU s zSet.copyc C s< t |tstd| |kr dS x|jD ]}| j| q&W dS )zUpdate the set, adding any elements from other which are not already in the set. @param other: the collection of items with which to update the set @type other: Set object z other must be a Set instanceN) isinstancer r r r )r otherr r r r union_updateY s zSet.union_updatec C sL t |tstd| |kr dS x(t| jD ]}||jkr*| jj| q*W dS )zUpdate the set, removing any elements from other which are not in both sets. @param other: the collection of items with which to update the set @type other: Set object z other must be a Set instanceN)r r r r r r )r r r r r r intersection_updatef s zSet.intersection_updatec C s@ t |tstd| |kr"g | _nx|jD ]}| j| q*W dS )zUpdate the set, removing any elements from other which are in the set. @param other: the collection of items with which to update the set @type other: Set object z other must be a Set instanceN)r r r r r )r r r r r r difference_updatev s zSet.difference_updatec C s | j }|j| |S )zReturn a new set which is the union of I{self} and I{other}. @param other: the other set @type other: Set object @rtype: the same type as I{self} )r r )r r r r r r union s z Set.unionc C s | j }|j| |S )zReturn a new set which is the intersection of I{self} and I{other}. @param other: the other set @type other: Set object @rtype: the same type as I{self} )r r )r r r r r r intersection s zSet.intersectionc C s | j }|j| |S )zReturn a new set which I{self} - I{other}, i.e. the items in I{self} which are not also in I{other}. @param other: the other set @type other: Set object @rtype: the same type as I{self} )r r )r r r r r r difference s zSet.differencec C s | j |S )N)r )r r r r r __or__ s z Set.__or__c C s | j |S )N)r )r r r r r __and__ s z Set.__and__c C s | j |S )N)r )r r r r r __add__ s z Set.__add__c C s | j |S )N)r )r r r r r __sub__ s z Set.__sub__c C s | j | | S )N)r )r r r r r __ior__ s z Set.__ior__c C s | j | | S )N)r )r r r r r __iand__ s z Set.__iand__c C s | j | | S )N)r )r r r r r __iadd__ s z Set.__iadd__c C s | j | | S )N)r )r r r r r __isub__ s z Set.__isub__c C s x|D ]}| j | qW dS )zUpdate the set, adding any elements from other which are not already in the set. @param other: the collection of items with which to update the set @type other: any iterable typeN)r )r r r r r r update s z Set.updatec C s g | _ dS )zMake the set empty.N)r )r r r r clear s z Set.clearc C s@ x | j D ]}||j krdS qW x |j D ]}|| j kr&dS q&W dS )NFT)r )r r r r r r __eq__ s z Set.__eq__c C s | j | S )N)r) )r r r r r __ne__ s z Set.__ne__c C s t | jS )N)lenr )r r r r __len__ s z Set.__len__c C s t | jS )N)iterr )r r r r __iter__ s z Set.__iter__c C s | j | S )N)r )r ir r r __getitem__ s zSet.__getitem__c C s | j |= d S )N)r )r r/ r r r __delitem__ s zSet.__delitem__c C s4 t |tstdx | jD ]}||jkrdS qW dS )z?Is I{self} a subset of I{other}? @rtype: bool z other must be a Set instanceFT)r r r r )r r r r r r issubset s z Set.issubsetc C s4 t |tstdx |jD ]}|| jkrdS qW dS )zAIs I{self} a superset of I{other}? @rtype: bool z other must be a Set instanceFT)r r r r )r r r r r r issuperset s zSet.issuperset)N)%__name__ __module__ __qualname____doc__ __slots__r r r r r r r r r r r r r r r r r! r" r# r$ r% r& r' r( r) r* r, r. r0 r1 r2 r3 r r r r r sD r N)r7 objectr r r r r <module> s PK g\f5 " __pycache__/entropy.cpython-36.pycnu [ 3 bWq @ s d dl Z d dlZd dlZddlmZmZ y d dlZW n ek rP d dl ZY nX G dd de Z e Z y ej ZW n ek r dZY nX dd Zdd ZdS ) N )long binary_typec @ sH e Zd ZdddZdddZdd Zd d Zd d Zd d Zdd Z dS ) EntropyPoolNc C s d| _ d | _d| _tj | _y dd l}|j | _d| _ W n^ t k r y dd l }|j | _d| _ W n, t k r dd l }|j | _d| _ Y nX Y nX td| j | _|d k r| jt| d| _tj | _n d| _d| _d S )Nr TF) pool_indexdigest next_byte _threadingZLocklockhashlibZsha1hashhash_len ImportErrorshanewmd5 bytearraypoolstirseededosgetpidseed_pid)selfseedr r r r /usr/lib/python3.6/entropy.py__init__ s0 zEntropyPool.__init__Fc C sr |s| j j zNxH|D ]@}| j| jkr,d| _|d@ }| j| j |N < | jd7 _qW W d |sl| j j X d S )Nr r )r acquirer r r release)r ZentropyZalready_lockedcbr r r r 7 s zEntropyPool.stirc C s | j s| jtj krytjd}W n` tk r y*tddd}z|jd}W d |j X W n tk r~ t t j }Y nX Y nX d| _ tj | _d | _ t |}| j |d d S )Nr z /dev/urandomrbr T)r r r r urandom Exceptionopenreadclosestrtimer r r )r r rr r r _maybe_seedE s zEntropyPool._maybe_seedc C s | j j zr| j | jd ks*| j| jkr`| jjt| j t | jj | _| j | jd d| _| j| j }| jd7 _W d | j j X |S )NTr r ) r r" r/ r r r r updater r r r r# )r valuer r r random_8X s zEntropyPool.random_8c C s | j d | j S )N )r2 )r r r r random_16g s zEntropyPool.random_16c C s | j d | j S )Ni )r4 )r r r r random_32j s zEntropyPool.random_32c C sl || d }|t dkr td|dkr8| j}t d}n |dkrL| j}d}n | j}d}||| |d S ) Nr l ztoo bigi l r3 i r! )r ValueErrorr5 r4 r2 )r firstlastsizeZrandmaxr r r random_betweenm s zEntropyPool.random_between)N)F) __name__ __module__ __qualname__r r r/ r2 r4 r5 r; r r r r r s r c C s t d k rt jddS tj S d S )Nr i ) system_random randranger r4 r r r r r4 s r4 c C s( t d k rt j| |d S tj| |S d S )Nr )r? r@ r r; )r7 r8 r r r between s rA )r Zrandomr- Z_compatr r Z threadingr r Zdummy_threadingobjectr r Z SystemRandomr? r( r4 rA r r r r <module> s b PK g\8Yw w & __pycache__/rrset.cpython-36.opt-1.pycnu [ 3 $Wk @ sl d Z ddlZddlZddlZddlZddlmZ G dd dejj Z dddZ d d Z dd d Z d d ZdS )z)DNS RRsets (an RRset is a named rdataset) N ) string_typesc s e Zd ZdZddgZejjdf fdd Z fddZ d d Z d d Z fd dZ d fdd Z d fdd Zd fdd Zdd Z ZS )RRseta6 A DNS RRset (named rdataset). RRset inherits from Rdataset, and RRsets can be treated as Rdatasets in most cases. There are, however, a few notable exceptions. RRsets have different to_wire() and to_text() method arguments, reflecting the fact that RRsets always have an owner name. namedeletingNc s$ t t| j||| || _|| _dS )zCreate a new RRset.N)superr __init__r r )selfr rdclassrdtypecoversr ) __class__ /usr/lib/python3.6/rrset.pyr ' s zRRset.__init__c s" t t| j }| j|_| j|_|S )N)r r _cloner r )r obj)r r r r / s z RRset._clonec C s | j dkrd}ndtjj| j d }| jd k rDdtjj| j }nd}dt| j d tjj| j d tjj| j | | d S ) Nr ()z delete=z<DNS z RRset>) r dns rdatatypeto_textr rdataclassstrr r r )r ZctextZdtextr r r __repr__5 s zRRset.__repr__c C s | j S )N)r )r r r r __str__B s z RRset.__str__c s. t |tsdS | j|jkr dS tt| j|S )zcTwo RRsets are equal if they have the same name and the same rdataset @rtype: boolF) isinstancer r r __eq__)r other)r r r r E s z RRset.__eq__c s4 t t| j|||sdS | j|ks,| j|kr0dS dS )zaReturns True if this rrset matches the specified class, type, covers, and deletion state.FT)r r matchr r )r r r r r r )r r r r P s z RRset.matchTc s t t| j| j||| jf|S )a Convert the RRset into DNS master file format. @see: L{dns.name.Name.choose_relativity} for more information on how I{origin} and I{relativize} determine the way names are emitted. Any additional keyword arguments are passed on to the rdata to_text() method. @param origin: The origin for relative names, or None. @type origin: dns.name.Name object @param relativize: True if names should names be relativized @type relativize: bool)r r r r r )r originZ relativizekw)r r r r Z s z RRset.to_textc s t t| j| j|||| jf|S )z!Convert the RRset to wire format.)r r to_wirer r )r filecompressr! r" )r r r r# l s z RRset.to_wirec C s t jj| jt| S )zYConvert an RRset into an Rdataset. @rtype: dns.rdataset.Rdataset object )r rdatasetfrom_rdata_listttllist)r r r r to_rdatasetr s zRRset.to_rdataset)N)NT)NN)__name__ __module__ __qualname____doc__ __slots__r r ZNONEr r r r r r r r# r* __classcell__r r )r r r s r c C s t | tr tjj| d|d} t |tr2tjj|}t |trHtjj|}t| ||}|j| x*|D ]"}tj j|j |j |}|j | qdW |S )zCreate an RRset with the specified name, TTL, class, and type, and with the specified list of rdatas in text format. @rtype: dns.rrset.RRset object N) idna_codec) r r r r from_textr r r update_ttlZrdatar r add) r r( r r text_rdatasr1 rtrdr r r from_text_listz s r9 c G s t | ||||S )zCreate an RRset with the specified name, TTL, class, and type and with the specified rdatas in text format. @rtype: dns.rrset.RRset object )r9 )r r( r r r5 r r r r2 s r2 c C sr t | tr tjj| d|d} t|dkr0tdd}x8|D ]0}|dkr`t| |j|j }|j | |j | q:W |S )zCreate an RRset with the specified name and TTL, and with the specified list of rdata objects. @rtype: dns.rrset.RRset object N)r1 r z rdata list must not be empty) r r r r r2 len ValueErrorr r r r3 r4 )r r( rdatasr1 r6 r8 r r r r' s r' c G s t | ||S )zCreate an RRset with the specified name and TTL, and with the specified rdata objects. @rtype: dns.rrset.RRset object )r' )r r( r< r r r from_rdata s r= )N)N)r. Zdns.namer Z dns.rdatasetZdns.rdataclassZ dns.rendererZ_compatr r& ZRdatasetr r9 r2 r' r= r r r r <module> s a PK g\VJ8 8 $ __pycache__/tokenizer.cpython-36.pycnu [ 3 bWG @ s d Z ddlmZ ddlZddlZddlZddlZddlm Z m Z m Z ddddddddZ ddiZ dZdZd Zd Zd Zd Zd ZG dd dejjZG dd deZG dd deZdS )z Tokenize DNS master file format )StringION )long text_type binary_typeT) ;()"r c @ s e Zd ZdZdS )UngetBufferFullzDAn attempt was made to unget a token when the unget buffer was full.N)__name__ __module__ __qualname____doc__ r r /usr/lib/python3.6/tokenizer.pyr . s r c @ s e Zd ZdZd%ddZdd Zdd Zd d Zd d Zdd Z dd Z dd Z dd Z dd Z dd Zdd Zd d Zd d Zd d! Zd"d# Zd$S )&TokenzA DNS master file format token. @ivar ttype: The token type @type ttype: int @ivar value: The token value @type value: string @ivar has_escape: Does the token value contain escapes? @type has_escape: bool Fc C s || _ || _|| _dS )a Initialize a token instance. @param ttype: The token type @type ttype: int @param value: The token value @type value: string @param has_escape: Does the token value contain escapes? @type has_escape: bool N)ttypevalue has_escape)selfr r r r r r __init__? s zToken.__init__c C s | j tkS )N)r EOF)r r r r is_eofM s z Token.is_eofc C s | j tkS )N)r EOL)r r r r is_eolP s z Token.is_eolc C s | j tkS )N)r WHITESPACE)r r r r is_whitespaceS s zToken.is_whitespacec C s | j tkS )N)r IDENTIFIER)r r r r is_identifierV s zToken.is_identifierc C s | j tkS )N)r QUOTED_STRING)r r r r is_quoted_stringY s zToken.is_quoted_stringc C s | j tkS )N)r COMMENT)r r r r is_comment\ s zToken.is_commentc C s | j tkS )N)r DELIMITER)r r r r is_delimiter_ s zToken.is_delimiterc C s | j tkp| j tkS )N)r r# r! )r r r r is_eol_or_eofb s zToken.is_eol_or_eofc C s& t |tsdS | j|jko$| j|jkS )NF) isinstancer r r )r otherr r r __eq__e s z Token.__eq__c C s& t |tsdS | j|jkp$| j|jkS )NT)r0 r r r )r r1 r r r __ne__k s z Token.__ne__c C s d| j | jf S )Nz%d "%s")r r )r r r r __str__q s z Token.__str__c C s | j s | S d}t| j}d}x||k r| j| }|d7 }|dkr||krPtjj| j| }|d7 }|j r||krztjj| j| }|d7 }||krtjj| j| }|d7 }|j o|j stjjtt |d t |d t | }||7 }q W t | j |S )Nr r r \d ) r lenr dns exception UnexpectedEndisdigit SyntaxErrorchrintr r )r Z unescapedlicc2c3r r r unescapet s6 $ zToken.unescapec C s dS )Nr r )r r r r __len__ s z Token.__len__c C s t | j| jfS )N)iterr r )r r r r __iter__ s zToken.__iter__c C s$ |dkr| j S |dkr | jS td S )Nr r )r r IndexError)r rA r r r __getitem__ s zToken.__getitem__N)r F)r r r r r r" r$ r& r( r* r, r. r/ r2 r3 r4 rE rF rH rJ r r r r r 3 s" r c @ s e Zd ZdZejdfddZdd Zdd Zd d Z d d Z d(ddZ dd Z dd Z e Zdd Zdd Zdd Zdd Zd d Zd)d d Zd*d d!Zd+d"d#Zd$d% Zd&d' ZdS ), Tokenizera A DNS master file format tokenizer. A token is a (type, value) tuple, where I{type} is an int, and I{value} is a string. The valid types are EOF, EOL, WHITESPACE, IDENTIFIER, QUOTED_STRING, COMMENT, and DELIMITER. @ivar file: The file to tokenize @type file: file @ivar ungotten_char: The most recently ungotten character, or None. @type ungotten_char: string @ivar ungotten_token: The most recently ungotten token, or None. @type ungotten_token: (int, string) token tuple @ivar multiline: The current multiline level. This value is increased by one every time a '(' delimiter is read, and decreased by one every time a ')' delimiter is read. @type multiline: int @ivar quoting: This variable is true if the tokenizer is currently reading a quoted string. @type quoting: bool @ivar eof: This variable is true if the tokenizer has encountered EOF. @type eof: bool @ivar delimiters: The current delimiter dictionary. @type delimiters: dict @ivar line_number: The current line number @type line_number: int @ivar filename: A filename that will be returned by the L{where} method. @type filename: string Nc C s t |tr t|}|dkr`d}n@t |trDt|j }|dkr`d}n |dkr`|tjkr\d}nd}|| _d| _d| _ d| _ d| _ d| _ t | _d| _|| _dS )a Initialize a tokenizer instance. @param f: The file to tokenize. The default is sys.stdin. This parameter may also be a string, in which case the tokenizer will take its input from the contents of the string. @type f: file or string @param filename: the name of the filename that the L{where} method will return. @type filename: string Nz<string>z<stdin>z<file>r Fr )r0 r r r decodesysstdinfile ungotten_charungotten_token multilinequotingeof _DELIMITERS delimiters line_numberfilename)r frX r r r r s* zTokenizer.__init__c C sZ | j dkrJ| jrd}qV| jjd}|dkr2d| _qV|dkrV| jd7 _n | j }d| _ |S )z<Read a character from input. @rtype: string Nr r Tr )rP rT rO readrW )r rB r r r _get_char s zTokenizer._get_charc C s | j | jfS )zReturn the current location in the input. @rtype: (string, int) tuple. The first item is the filename of the input, the second is the current line number. )rX rW )r r r r where s zTokenizer.wherec C s | j dk rt|| _ dS )aE Unget a character. The unget buffer for characters is only one character large; it is an error to try to unget a character when the unget buffer is not empty. @param c: the character to unget @type c: string @raises UngetBufferFull: there is already an ungotten char N)rP r )r rB r r r _unget_char s zTokenizer._unget_charc C sL d}xB| j }|dkr<|dkr<|dks.| j r<| j| |S |d7 }qW dS )a( Consume input until a non-whitespace character is encountered. The non-whitespace character is then ungotten, and the number of whitespace characters consumed is returned. If the tokenizer is in multiline mode, then newlines are whitespace. @rtype: int r r r r r N)r[ rR r] )r skippedrB r r r skip_whitespace s zTokenizer.skip_whitespaceFc C sT | j dk r>| j }d| _ |j r(|r>|S n|j r:|r>|S n|S | j }|r\|dkr\ttdS d}t}d}x| j }|dks|| jkr|dkr| j rt j j |dko|t kr|dkr| jd7 _| j qlq |dkr | jdkrt j j| jd8 _| j qln|d krH| j s0d | _ t| _t }qlnd| _ t| _| j qln|d kr\ttd S |d krx,| j }|d ks|dkrP ||7 }qhW |r| j| tt|S |dkr| jrt j jd ttS | jr| j d}qln ttd S n|}t}n | j| P n| j r|dkr| j }|dkr>t j j |j r| j }|dkrbt j j | j } |dkr|t j j |j o| j st j jtt|d t|d t| }n|d krt j jdn:|dkr||7 }d }| j }|dks|d krt j j ||7 }qlW |dkrH|t krH| jrDt j jd t}t|||S )a Get the next token. @param want_leading: If True, return a WHITESPACE token if the first character read is whitespace. The default is False. @type want_leading: bool @param want_comment: If True, return a COMMENT token if the first token read is a comment. The default is False. @type want_comment: bool @rtype: Token object @raises dns.exception.UnexpectedEnd: input ended prematurely @raises dns.exception.SyntaxError: input was badly formed Nr r r Fr r r r Tr r zunbalanced parenthesesr5 r6 r7 znewline in quoted string)rQ r& r, r_ r r% r' r[ rV rS r9 r: r; r) rR r= _QUOTING_DELIMITERSrU r# r] r+ r! r- r< r> r? ) r Z want_leadingZ want_commenttokenr^ r r rB rC rD r r r get% s & z Tokenizer.getc C s | j dk rt|| _ dS )a@ Unget a token. The unget buffer for tokens is only one token large; it is an error to try to unget a token when the unget buffer is not empty. @param token: the token to unget @type token: Token object @raises UngetBufferFull: there is already an ungotten token N)rQ r )r ra r r r unget s zTokenizer.ungetc C s | j }|j rt|S )zLReturn the next item in an iteration. @rtype: (int, string) )rb r" StopIteration)r ra r r r next s zTokenizer.nextc C s | S )Nr )r r r r rH s zTokenizer.__iter__c C s@ | j j }|j s tjjd|jj s6tjjdt|jS )z|Read the next token and interpret it as an integer. @raises dns.exception.SyntaxError: @rtype: int zexpecting an identifierzexpecting an integer) rb rE r( r9 r: r= r r< r? )r ra r r r get_int s zTokenizer.get_intc C s, | j }|dk s|dkr(tjjd| |S )zRead the next token and interpret it as an 8-bit unsigned integer. @raises dns.exception.SyntaxError: @rtype: int r z#%d is not an unsigned 8-bit integer)rf r9 r: r= )r r r r r get_uint8 s zTokenizer.get_uint8c C s, | j }|dk s|dkr(tjjd| |S )zRead the next token and interpret it as a 16-bit unsigned integer. @raises dns.exception.SyntaxError: @rtype: int r i z$%d is not an unsigned 16-bit integer)rf r9 r: r= )r r r r r get_uint16 s zTokenizer.get_uint16c C sh | j j }|j s tjjd|jj s6tjjdt|j}|dk sT|tdkrdtjjd| |S )zRead the next token and interpret it as a 32-bit unsigned integer. @raises dns.exception.SyntaxError: @rtype: int zexpecting an identifierzexpecting an integerr l z$%d is not an unsigned 32-bit integer) rb rE r( r9 r: r= r r< r )r ra r r r r get_uint32 s zTokenizer.get_uint32c C s. | j j }|j p|j s(tjjd|jS )z}Read the next token and interpret it as a string. @raises dns.exception.SyntaxError: @rtype: string zexpecting a string)rb rE r( r* r9 r: r= r )r originra r r r get_string s zTokenizer.get_stringc C s& | j j }|j s tjjd|jS )zRead the next token and raise an exception if it is not an identifier. @raises dns.exception.SyntaxError: @rtype: string zexpecting an identifier)rb rE r( r9 r: r= r )r rk ra r r r get_identifier s zTokenizer.get_identifierc C s, | j }|j s tjjdtjj|j|S )zRead the next token and interpret it as a DNS name. @raises dns.exception.SyntaxError: @rtype: dns.name.Name objectzexpecting an identifier)rb r( r9 r: r= name from_textr )r rk ra r r r get_name s zTokenizer.get_namec C s. | j }|j s(tjjd|j|jf |jS )zRead the next token and raise an exception if it isn't EOL or EOF. @raises dns.exception.SyntaxError: @rtype: string z expected EOL or EOF, got %d "%s")rb r/ r9 r: r= r r )r ra r r r get_eol! s zTokenizer.get_eolc C s. | j j }|j s tjjdtjj|jS )Nzexpecting an identifier) rb rE r( r9 r: r= Zttlro r )r ra r r r get_ttl0 s zTokenizer.get_ttl)FF)N)N)N)r r r r rM rN r r[ r\ r] r_ rb rc re __next__rH rf rh ri rj rl rm rp rq rr r r r r rK s( $ { rK )r ior rM Z dns.exceptionr9 Zdns.nameZdns.ttlZ_compatr r r rU r` r! r# r% r' r) r+ r- r: Z DNSExceptionr objectr rK r r r r <module> s0 oPK g\! ! , __pycache__/reversename.cpython-36.opt-1.pycnu [ 3 bW @ sX d Z ddlZddlZddlZddlZddlZejjdZ ejjdZ dd Z dd Z dS ) a DNS Reverse Map Names. @var ipv4_reverse_domain: The DNS IPv4 reverse-map domain, in-addr.arpa. @type ipv4_reverse_domain: dns.name.Name object @var ipv6_reverse_domain: The DNS IPv6 reverse-map domain, ip6.arpa. @type ipv6_reverse_domain: dns.name.Name object Nz in-addr.arpa.z ip6.arpa.c C s yzt jj| }t jj|rXtjd kr<dd |dd D }ndd |dd D }t}n dd ttj |j D }t }W n2 t k r dd t t jj| D }t}Y nX |j t jjd j||d S ) a Convert an IPv4 or IPv6 address in textual form into a Name object whose value is the reverse-map domain name of the address. @param text: an IPv4 or IPv6 address in textual form (e.g. '127.0.0.1', '::1') @type text: str @rtype: dns.name.Name object c S s g | ] }d | qS )z%d ).0byter r !/usr/lib/python3.6/reversename.py <listcomp>/ s z from_address.<locals>.<listcomp> Nc S s g | ]}d t | qS )z%d)ord)r r r r r r 1 s c S s g | ]}|qS r r )r xr r r r 4 s c S s g | ] }d | qS )z%dr )r r r r r r 7 s .)origin)r )dnsipv6 inet_atonZ is_mappedsys version_infoipv4_reverse_domainstrbinasciiZhexlifydecodeipv6_reverse_domain Exception bytearrayipv4reversename from_textjoin)textZv6partsr r r r from_address# s r c C s | j trD| jt} t| j}|j dj|}tjj tjj |S | j t r| jt } t| j}|j g }d}t |}x0||k r|j dj|||d |d7 }q|W dj|}tjj tjj |S tjjddS )zConvert a reverse map domain name into textual address form. @param name: an IPv4 or IPv6 address in reverse-map form. @type name: dns.name.Name object @rtype: str .r :z"unknown reverse-map address familyN)Z is_subdomainr Z relativizelistlabelsr r r r Z inet_ntoar r lenappendr Z exception SyntaxError)r r& r r ilr r r to_address> s& r, ) __doc__r r Zdns.namer Zdns.ipv6Zdns.ipv4r r r r r r, r r r r <module> s PK g\=*ᴈ ' __pycache__/grange.cpython-36.opt-1.pycnu [ 3 bW @ s d Z ddlZdd ZdS )z DNS GENERATE range conversion. Nc C s d}d}d}| r(| d dkr(t jjdxj| D ]b}|dkrT|dkrTt|}d}d}q.|dkrnt|}d}d}q.|j r||7 }q.t jjd | q.W |d krt jj |dkrt|}|dkrt|}|||fS ) zConvert the text form of a range in a GENERATE statement to an integer. @param text: the textual range @type text: string @return: The start, stop and step values. @rtype: tuple r -z!Start cannot be a negative number / zCould not parse %s )r r )dnsZ exception SyntaxErrorintisdigit)textstepZcurstatecstartstop r /usr/lib/python3.6/grange.py from_text s0 r )__doc__r r r r r r <module> s PK g\ + __pycache__/rdataclass.cpython-36.opt-1.pycnu [ 3 bW @ s d Z ddlZddlZdZdZdZdZdZdZ eeeeee dZ e d d e j D Z e jeeed ed e d iZejd ejZG dd dejjZdd Zdd Zdd ZdS )ak DNS Rdata Classes. @var _by_text: The rdata class textual name to value mapping @type _by_text: dict @var _by_value: The rdata class value to textual name mapping @type _by_value: dict @var _metaclasses: If an rdataclass is a metaclass, there will be a mapping whose key is the rdatatype value and whose value is True in this dictionary. @type _metaclasses: dict N ) RESERVED0INCHHSNONEANYc c s | ]\}}||fV qd S )N ).0xyr r /usr/lib/python3.6/rdataclass.py <genexpr>2 s r )ZINTERNETZCHAOSZHESIODTzCLASS([0-9]+)$c @ s e Zd ZdZdS )UnknownRdataclasszA DNS class is unknown.N)__name__ __module__ __qualname____doc__r r r r r E s r c C sV t j| j }|dkrRtj| }|dkr,tt|jd}|dk sJ|dkrRtd|S )zConvert text into a DNS rdata class value. @param text: the text @type text: string @rtype: int @raises dns.rdataclass.UnknownRdataclass: the class is unknown @raises ValueError: the rdata class value is not >= 0 and <= 65535 Nr r i z'class must be between >= 0 and <= 65535) _by_textgetupper_unknown_class_patternmatchr intgroup ValueError)textvaluer r r r from_textJ s r" c C s: | dk s| dkrt dtj| }|dkr6dt| }|S )zConvert a DNS rdata class to text. @param value: the rdata class value @type value: int @rtype: string @raises ValueError: the rdata class value is not >= 0 and <= 65535 r i z'class must be between >= 0 and <= 65535NZCLASS)r _by_valuer repr)r! r r r r to_text^ s r% c C s | t kr dS dS )zmTrue if the class is a metaclass. @param rdclass: the rdata class @type rdclass: int @rtype: boolTF) _metaclasses)Zrdclassr r r is_metaclassn s r' )r reZ dns.exceptionZdnsr r r r r r r dictitemsr# updater& compileIr Z exceptionZ DNSExceptionr r" r% r' r r r r <module> s4 PK g\! ! & __pycache__/reversename.cpython-36.pycnu [ 3 bW @ sX d Z ddlZddlZddlZddlZddlZejjdZ ejjdZ dd Z dd Z dS ) a DNS Reverse Map Names. @var ipv4_reverse_domain: The DNS IPv4 reverse-map domain, in-addr.arpa. @type ipv4_reverse_domain: dns.name.Name object @var ipv6_reverse_domain: The DNS IPv6 reverse-map domain, ip6.arpa. @type ipv6_reverse_domain: dns.name.Name object Nz in-addr.arpa.z ip6.arpa.c C s yzt jj| }t jj|rXtjd kr<dd |dd D }ndd |dd D }t}n dd ttj |j D }t }W n2 t k r dd t t jj| D }t}Y nX |j t jjd j||d S ) a Convert an IPv4 or IPv6 address in textual form into a Name object whose value is the reverse-map domain name of the address. @param text: an IPv4 or IPv6 address in textual form (e.g. '127.0.0.1', '::1') @type text: str @rtype: dns.name.Name object c S s g | ] }d | qS )z%d ).0byter r !/usr/lib/python3.6/reversename.py <listcomp>/ s z from_address.<locals>.<listcomp> Nc S s g | ]}d t | qS )z%d)ord)r r r r r r 1 s c S s g | ]}|qS r r )r xr r r r 4 s c S s g | ] }d | qS )z%dr )r r r r r r 7 s .)origin)r )dnsipv6 inet_atonZ is_mappedsys version_infoipv4_reverse_domainstrbinasciiZhexlifydecodeipv6_reverse_domain Exception bytearrayipv4reversename from_textjoin)textZv6partsr r r r from_address# s r c C s | j trD| jt} t| j}|j dj|}tjj tjj |S | j t r| jt } t| j}|j g }d}t |}x0||k r|j dj|||d |d7 }q|W dj|}tjj tjj |S tjjddS )zConvert a reverse map domain name into textual address form. @param name: an IPv4 or IPv6 address in reverse-map form. @type name: dns.name.Name object @rtype: str .r :z"unknown reverse-map address familyN)Z is_subdomainr Z relativizelistlabelsr r r r Z inet_ntoar r lenappendr Z exception SyntaxError)r r& r r ilr r r to_address> s& r, ) __doc__r r Zdns.namer Zdns.ipv6Zdns.ipv4r r r r r r, r r r r <module> s PK g\|g g __pycache__/e164.cpython-36.pycnu [ 3 bWK @ s\ d Z ddlZddlZddlZddlmZ ejjdZ e fddZ e dfd d Z d d d Z dS )zDNS E.164 helpers @var public_enum_domain: The DNS public ENUM domain, e164.arpa. @type public_enum_domain: dns.name.Name object N ) string_typesz e164.arpa.c C s, dd | D }|j tjjdj||dS )au Convert an E.164 number in textual form into a Name object whose value is the ENUM domain name for that number. @param text: an E.164 number in textual form. @type text: str @param origin: The domain in which the number should be constructed. The default is e164.arpa. @type origin: dns.name.Name object or None @rtype: dns.name.Name object c S s g | ]}|j r|qS )isdigit).0dr r /usr/lib/python3.6/e164.py <listcomp>) s z from_e164.<locals>.<listcomp>.)origin)reversednsname from_textjoin)textr partsr r r from_e164 s r Tc C sb |dk r| j |} dd | jD }t|t| jkr@tjjd|j dj|}|r^d| }|S )a Convert an ENUM domain name into an E.164 number. @param name: the ENUM domain name. @type name: dns.name.Name object. @param origin: A domain containing the ENUM domain name. The name is relativized to this domain before being converted to text. @type origin: dns.name.Name object or None @param want_plus_prefix: if True, add a '+' to the beginning of the returned number. @rtype: str Nc S s$ g | ] }|j rt|d kr|qS )r )r len)r r r r r r ; s zto_e164.<locals>.<listcomp>z$non-digit labels in ENUM domain name +)Z relativizeZlabelsr r Z exception SyntaxErrorr r )r r Zwant_plus_prefixZdlabelsr r r r to_e164. s r c C s |dkrt jj }t jj }xl|D ]d}t|tr<t jj|}t jj | |}y |j |dS t jjk r } z||7 }W Y dd}~X q"X q"W |dS )zLook for NAPTR RRs for the specified number in the specified domains. e.g. lookup('16505551212', ['e164.dnspython.org.', 'e164.arpa.']) NZNAPTR) r resolverZget_default_resolverZNXDOMAIN isinstancer r r Ze164r query)ZnumberZdomainsr Ze_nxZdomainZqnameer r r r E s r )N) __doc__Z dns.exceptionr Zdns.nameZ dns.resolverZ_compatr r r Zpublic_enum_domainr r r r r r r <module> s PK g\k' ' ) __pycache__/namedict.cpython-36.opt-1.pycnu [ 3 bW] @ s6 d Z ddlZddlZddlmZ G dd dejZdS )zDNS name dictionary N )xrangec @ sb e Zd ZdZdddgZdd Zdd Zd d Zd d Zd d Z dd Z dd Z dd Z dd Z dS )NameDicta A dictionary whose keys are dns.name.Name objects. @ivar max_depth: the maximum depth of the keys that have ever been added to the dictionary. @type max_depth: int @ivar max_depth_items: the number of items of maximum depth @type max_depth_items: int max_depthmax_depth_itemsZ__storec O s( t | _d| _d| _| jt || d S )Nr )dict_NameDict__storer r update)selfargskwargs r /usr/lib/python3.6/namedict.py__init__- s zNameDict.__init__c C s> t || jkr | jd | _n t || jkr:t || _d| _d S )Nr )lenr r )r keyr r r Z__update_max_depth3 s zNameDict.__update_max_depthc C s | j | S )N)r )r r r r r __getitem__: s zNameDict.__getitem__c C s. t |tjjstd|| j|< | j| d S )NzNameDict key must be a name) isinstancednsnameName ValueErrorr _NameDict__update_max_depth)r r valuer r r __setitem__= s zNameDict.__setitem__c C sT | j j|}t|| jkr&| jd | _| jdkrPd| _x| j D ]}| j| q>W d S )Nr r )r popr r r r )r r r kr r r __delitem__C s zNameDict.__delitem__c C s t | jS )N)iterr )r r r r __iter__L s zNameDict.__iter__c C s t | jS )N)r r )r r r r __len__O s zNameDict.__len__c C s || j kS )N)r )r r r r r has_keyR s zNameDict.has_keyc C sn t |}|| jkr| j}x<t| dD ],}tjj||d }|| kr&|| | fS q&W | tjj }tjj|fS )a Find the deepest match to I{name} in the dictionary. The deepest match is the longest name in the dictionary which is a superdomain of I{name}. @param name: the name @type name: dns.name.Name object @rtype: (key, value) tuple r N)r r r r r r empty)r r depthinvr r r get_deepest_matchU s zNameDict.get_deepest_matchN)__name__ __module__ __qualname____doc__ __slots__r r r r r r r r! r' r r r r r ! s r )r+ collectionsZdns.namer Z_compatr MutableMappingr r r r r <module> s PK g\pp * __pycache__/rdatatype.cpython-36.opt-1.pycnu [ 3 W F @ s0 d Z ddlZddlZdZdZdZdZdZdZ dZ d Z d Z d Z d Zd ZdZdZdZdZdZdZdZdZdZdZdZdZdZ dZ d Z d Z d Z d Z!d Z"d!Z#d"Z$d#Z%d$Z&d%Z'd&Z(d'Z)d(Z*d)Z+d*Z,d+Z-d,Z.d-Z/d.Z0d/Z1d0Z2d1Z3d2Z4d3Z5d4Z6d5Z7d6Z8d7Z9d8Z:d9Z;d:Z<d;Z=d<Z>d=Z?d>Z@d?ZAd@ZBdAZCdBZDdCZEdDZFdEZGdFZHeeeeee e e e e eeeeeeeeeeeeeee e e e e e!e"e#e$e%e&e'e(e)e*e+e,e-e.e/e0e1e2e3e4e5e6e7e8e9e:e;e<e=e>e?e@eAeBeCeDeEeFeGeHdGEZIeJdHdI eIjK D ZLe)dJiZMe dJe"dJe(dJe/dJiZNejOdKejPZQG dLdM dMejRjSZTdNdO ZUdPdQ ZVdRdS ZWdTdU ZXdS )Va DNS Rdata Types. @var _by_text: The rdata type textual name to value mapping @type _by_text: dict @var _by_value: The rdata type value to textual name mapping @type _by_value: dict @var _metatypes: If an rdatatype is a metatype, there will be a mapping whose key is the rdatatype value and whose value is True in this dictionary. @type _metatypes: dict @var _singletons: If an rdatatype is a singleton, there will be a mapping whose key is the rdatatype value and whose value is True in this dictionary. @type _singletons: dict N ! # $ % & ' ) * + , - . / 0 1 2 3 4 7 ; < > c g l m i i i i )ENONEANSMDMFCNAMESOAMBMGMRNULLWKSPTRHINFOMINFOMXTXTRPAFSDBX25ISDNRTNSAPzNSAP-PTRSIGKEYPXGPOSAAAALOCNXTSRVNAPTRKXCERTA6DNAMEOPTAPLDSSSHFPIPSECKEYRRSIGNSECDNSKEYDHCIDNSEC3 NSEC3PARAMTLSAHIPCDSCDNSKEYCSYNCSPFUNSPECEUI48EUI64TKEYTSIGIXFRAXFRMAILBMAILAANYURICAAAVCTADLVc c s | ]\}}||fV qd S )N ).0xyr r /usr/lib/python3.6/rdatatype.py <genexpr> s r Tz TYPE([0-9]+)$c @ s e Zd ZdZdS )UnknownRdatatypez$DNS resource record type is unknown.N)__name__ __module__ __qualname____doc__r r r r r s r c C sV t j| j }|dkrRtj| }|dkr,tt|jd}|dk sJ|dkrRtd|S )zConvert text into a DNS rdata type value. @param text: the text @type text: string @raises dns.rdatatype.UnknownRdatatype: the type is unknown @raises ValueError: the rdata type value is not >= 0 and <= 65535 @rtype: intNr r i z&type must be between >= 0 and <= 65535) _by_textgetupper_unknown_type_patternmatchr intgroup ValueError)textvaluer r r r from_text s r c C s: | dk s| dkrt dtj| }|dkr6dt| }|S )zConvert a DNS rdata type to text. @param value: the rdata type value @type value: int @raises ValueError: the rdata type value is not >= 0 and <= 65535 @rtype: stringr i z&type must be between >= 0 and <= 65535NZTYPE)r _by_valuer repr)r r r r r to_text s r c C s | t kr| tks| tkr dS dS )zbTrue if the type is a metatype. @param rdtype: the type @type rdtype: int @rtype: boolTF)rz r _metatypes)rdtyper r r is_metatype s r c C s | t kr dS dS )zcTrue if the type is a singleton. @param rdtype: the type @type rdtype: int @rtype: boolTF) _singletons)r r r r is_singleton s r )Yr reZ dns.exceptionZdnsrB rC rD rE rF rG rH rI rJ rK rL rM rN rO rP rQ rR rS rT rU rV rW rX ZNSAP_PTRrY rZ r[ r\ r] r^ r_ r` ra rb rc rd re rf rg rh ri rj rk rl rm rn ro rp rq rr rs rt ru rv rw rx ry rz r{ r| r} r~ r r r r r r r r dictitemsr r r compileIr Z exceptionZ DNSExceptionr r r r r r r r r <module> s0 PK g\5 n n ( __pycache__/message.cpython-36.opt-1.pycnu [ 3 @Wy @ s d Z ddlmZ ddlmZ ddlZddlZddlZddl Zddl Zddl Zddl Zddl ZddlZddlZddlZddlZddlZddlZddlZddlZddlmZmZmZ G dd dejjZ G d d d ejjZ G d d d ejj Z G d d dejjZ G dd dejjZ!G dd dejj Z"G dd de#Z$G dd de#Z%d(ddZ&G d d d e#Z'd d Z(d d! Z)ej*j+ddddddfd"d#Z,d)d&d'Z-dS )*z DNS Messages )absolute_import)StringION )longxrange string_typesc @ s e Zd ZdZdS ) ShortHeaderz2The DNS packet passed to from_wire() is too short.N)__name__ __module__ __qualname____doc__ r r /usr/lib/python3.6/message.pyr * s r c @ s e Zd ZdZdS ) TrailingJunkzEThe DNS packet passed to from_wire() has extra junk at the end of it.N)r r r r r r r r r / s r c @ s e Zd ZdZdS )UnknownHeaderFieldzVThe header field name was not recognized when converting from text into a message.N)r r r r r r r r r 4 s r c @ s e Zd ZdZdS )BadEDNSzVOPT record occurred somewhere other than the start of the additional data section.N)r r r r r r r r r : s r c @ s e Zd ZdZdS )BadTSIGzWA TSIG record occurred somewhere other than the end of the additional data section.N)r r r r r r r r r @ s r c @ s e Zd ZdZdS )UnknownTSIGKeyz(A TSIG with an unknown key was received.N)r r r r r r r r r F s r c @ s e Zd ZdZd-ddZdd Zdd Zd.d d Zd d Zdd Z dd Z dd Z e j jdddfddZe j jdddfddZd/ddZdd ddd e jjfd d Zd0d!d"Zd1d#d$Zd%d& Zd'd( Zd)d* Zd+d, ZdS )2Messagea, A DNS message. @ivar id: The query id; the default is a randomly chosen id. @type id: int @ivar flags: The DNS flags of the message. @see: RFC 1035 for an explanation of these flags. @type flags: int @ivar question: The question section. @type question: list of dns.rrset.RRset objects @ivar answer: The answer section. @type answer: list of dns.rrset.RRset objects @ivar authority: The authority section. @type authority: list of dns.rrset.RRset objects @ivar additional: The additional data section. @type additional: list of dns.rrset.RRset objects @ivar edns: The EDNS level to use. The default is -1, no Edns. @type edns: int @ivar ednsflags: The EDNS flags @type ednsflags: long @ivar payload: The EDNS payload size. The default is 0. @type payload: int @ivar options: The EDNS options @type options: list of dns.edns.Option objects @ivar request_payload: The associated request's EDNS payload size. @type request_payload: int @ivar keyring: The TSIG keyring to use. The default is None. @type keyring: dict @ivar keyname: The TSIG keyname to use. The default is None. @type keyname: dns.name.Name object @ivar keyalgorithm: The TSIG algorithm to use; defaults to dns.tsig.default_algorithm. Constants for TSIG algorithms are defined in dns.tsig, and the currently implemented algorithms are HMAC_MD5, HMAC_SHA1, HMAC_SHA224, HMAC_SHA256, HMAC_SHA384, and HMAC_SHA512. @type keyalgorithm: string @ivar request_mac: The TSIG MAC of the request message associated with this message; used when validating TSIG signatures. @see: RFC 2845 for more information on TSIG fields. @type request_mac: string @ivar fudge: TSIG time fudge; default is 300 seconds. @type fudge: int @ivar original_id: TSIG original id; defaults to the message's id @type original_id: int @ivar tsig_error: TSIG error code; default is 0. @type tsig_error: int @ivar other_data: TSIG other data. @type other_data: string @ivar mac: The TSIG MAC for this message. @type mac: string @ivar xfr: Is the message being used to contain the results of a DNS zone transfer? The default is False. @type xfr: bool @ivar origin: The origin of the zone in messages which are used for zone transfers or for DNS dynamic updates. The default is None. @type origin: dns.name.Name object @ivar tsig_ctx: The TSIG signature context associated with this message. The default is None. @type tsig_ctx: hmac.HMAC object @ivar had_tsig: Did the message decoded from wire format have a TSIG signature? @type had_tsig: bool @ivar multi: Is this message part of a multi-message sequence? The default is false. This variable is used when validating TSIG signatures on messages which are part of a zone transfer. @type multi: bool @ivar first: Is this message standalone, or the first of a multi message sequence? This variable is used when validating TSIG signatures on messages which are part of a zone transfer. @type first: bool @ivar index: An index of rrsets in the message. The index key is (section, name, rdclass, rdtype, covers, deleting). Indexing can be disabled by setting the index to None. @type index: dict Nc C s |d krt jj | _n|| _d| _g | _g | _g | _g | _d| _ d| _ d| _ g | _ d| _ d | _d | _t jj| _d| _d| _d| _d| _| j| _d| _d| _d | _d | _d| _ d| _ d| _ i | _ d S )Nr r i, FT) dnsZentropyZ random_16idflagsquestionanswer authority additionaledns ednsflagspayloadoptionsrequest_payloadkeyringkeynametsigdefault_algorithm keyalgorithm request_mac other_data tsig_errorfudge original_idmacxfrorigintsig_ctxhad_tsigmultifirstindex)selfr r r r __init__ s: zMessage.__init__c C s dt | j d S )Nz<DNS message, ID >)reprr )r5 r r r __repr__ s zMessage.__repr__c C s | j S )N)to_text)r5 r r r __str__ s zMessage.__str__Tc K s t }|jd| j |jdtjjtjj| j tjj| j| j }|jdtjj| |jdtjj| j | j dkr|jd| j | j dkr|jdtjj | j |jd| j tjj | j}|r|jd n |jd x.| jD ]$}|j|j||f| |jd qW |r,|jd n |jd x0| jD ]&}|j|j||f| |jd q>W |rz|jd n |jd x0| jD ]&}|j|j||f| |jd qW |jd x0| jD ]&}|j|j||f| |jd qW |j dd S )zConvert the message to text. The I{origin}, I{relativize}, and any other keyword arguments are passed to the rrset to_wire() method. @rtype: string zid %d z opcode %s z rcode %s z flags %s r zedns %s z eflags %s z payload %d z;ZONE z ;QUESTION z;PREREQ z;ANSWER z;UPDATE z ;AUTHORITY z ;ADDITIONAL Nr r )r writer r opcoder: from_flagsr rcoder r Z edns_to_textr is_updater r r r getvalue)r5 r/ relativizekwsZrcrA rrsetr r r r: sJ zMessage.to_textc C s t |tsdS | j|jkr dS | j|jkr.dS x | jD ]}||jkr6dS q6W x |jD ]}|| jkrTdS qTW x | jD ]}||jkrrdS qrW x |jD ]}|| jkrdS qW x | jD ]}||jkrdS qW x |jD ]}|| jkrdS qW dS )zTwo messages are equal if they have the same content in the header, question, answer, and authority sections. @rtype: boolFT) isinstancer r r r r r )r5 othernr r r __eq__ s2 zMessage.__eq__c C s | j | S )z0Are two messages not equal? @rtype: bool)rJ )r5 rH r r r __ne__ s zMessage.__ne__c C s |j tj j@ dks:| j|jks:tjj| j tjj|j kr>dS tjj|j |jtjjkr\dS tjj | j rndS x | j D ]}||j krvdS qvW x |j D ]}|| j krdS qW dS )z1Is other a response to self? @rtype: boolr FT) r r QRr r> r? r@ r ZNOERRORrA r )r5 rH rI r r r is_response s" zMessage.is_responsec C sD || j krdS || jkr dS || jkr*dS || jkr8dS tdd S )Nr r zunknown section)r r r r ValueError)r5 sectionr r r section_number- s zMessage.section_numberFc C s | j ||||||f} |sb| jdk r>| jj| } | dk rb| S n$x"|D ]} | j|||||rD| S qDW |sjttjj|||||} |j| | jdk r| | j| < | S )a Find the RRset with the given attributes in the specified section. @param section: the section of the message to look in, e.g. self.answer. @type section: list of dns.rrset.RRset objects @param name: the name of the RRset @type name: dns.name.Name object @param rdclass: the class of the RRset @type rdclass: int @param rdtype: the type of the RRset @type rdtype: int @param covers: the covers value of the RRset @type covers: int @param deleting: the deleting value of the RRset @type deleting: int @param create: If True, create the RRset if it is not found. The created RRset is appended to I{section}. @type create: bool @param force_unique: If True and create is also True, create a new RRset regardless of whether a matching RRset exists already. @type force_unique: bool @raises KeyError: the RRset was not found and create was False @rtype: dns.rrset.RRset objectN) rR r4 getmatchKeyErrorr rF ZRRsetappend) r5 rQ namerdclassrdtypecoversdeletingcreate force_uniquekeyrF r r r find_rrset9 s" zMessage.find_rrsetc C s: y | j ||||||||} W n tk r4 d} Y nX | S )a Get the RRset with the given attributes in the specified section. If the RRset is not found, None is returned. @param section: the section of the message to look in, e.g. self.answer. @type section: list of dns.rrset.RRset objects @param name: the name of the RRset @type name: dns.name.Name object @param rdclass: the class of the RRset @type rdclass: int @param rdtype: the type of the RRset @type rdtype: int @param covers: the covers value of the RRset @type covers: int @param deleting: the deleting value of the RRset @type deleting: int @param create: If True, create the RRset if it is not found. The created RRset is appended to I{section}. @type create: bool @param force_unique: If True and create is also True, create a new RRset regardless of whether a matching RRset exists already. @type force_unique: bool @rtype: dns.rrset.RRset object or NoneN)r_ rU ) r5 rQ rW rX rY rZ r[ r\ r] rF r r r get_rrsetg s zMessage.get_rrsetr c K sR |dkr | j dkr| j }nd}|dk r,d}n |dkr8d}tjj| j| j||}x"| jD ]}|j|j|j |j qVW x"| j D ]}|j tjj |f| qzW x"| jD ]}|j tjj|f| qW | jdkr|j| j| j| j| j x"| jD ]}|j tjj|f| qW |j | jdk rJ|j| j| j| j | j| j | j | j | j | j |j!| _!|j" S )a7 Return a string containing the message in DNS compressed wire format. Additional keyword arguments are passed to the rrset to_wire() method. @param origin: The origin to be appended to any relative names. @type origin: dns.name.Name object @param max_size: The maximum size of the wire format output; default is 0, which means 'the message's request payload, if nonzero, or 65536'. @type max_size: int @raises dns.exception.TooBig: max_size was exceeded @rtype: string r i i N)#r" r ZrendererZRendererr r r Z add_questionrW rY rX r Z add_rrsetANSWERr AUTHORITYr Zadd_ednsr r r! r ADDITIONALZ write_headerr$ Zadd_tsigr# r+ r, r* r) r( r' r- Zget_wire)r5 r/ Zmax_sizerD rrF r r r to_wire s6 zMessage.to_wirei, r c C st || _ |dkr$t| j j d | _n t|tr:tjj|}|| _|| _ || _ |dkr^| j | _ n|| _ || _ || _dS )aw When sending, a TSIG signature using the specified keyring and keyname should be added. @param keyring: The TSIG keyring to use; defaults to None. @type keyring: dict @param keyname: The name of the TSIG key to use; defaults to None. The key must be defined in the keyring. If a keyring is specified but a keyname is not, then the key used will be the first key in the keyring. Note that the order of keys in a dictionary is not defined, so applications should supply a keyname when a keyring is used, unless they know the keyring contains only one key. @type keyname: dns.name.Name or string @param fudge: TSIG time fudge; default is 300 seconds. @type fudge: int @param original_id: TSIG original id; defaults to the message's id @type original_id: int @param tsig_error: TSIG error code; default is 0. @type tsig_error: int @param other_data: TSIG other data. @type other_data: string @param algorithm: The TSIG algorithm to use; defaults to dns.tsig.default_algorithm Nr )r# listkeysr$ rG r r rW from_textr' r+ r r, r* r) )r5 r# r$ r+ r, r* r) algorithmr r r use_tsig s zMessage.use_tsig c C s |dks|dkrd}|dkr d}|dkr,|}|dk rFd}d}d}g }n$|t dM }||d> O }|dkrjg }|| _|| _|| _|| _|| _dS ) a_ Configure EDNS behavior. @param edns: The EDNS level to use. Specifying None, False, or -1 means 'do not use EDNS', and in this case the other parameters are ignored. Specifying True is equivalent to specifying 0, i.e. 'use EDNS0'. @type edns: int or bool or None @param ednsflags: EDNS flag values. @type ednsflags: int @param payload: The EDNS sender's payload field, which is the maximum size of UDP datagram the sender can handle. @type payload: int @param request_payload: The EDNS payload size to use when sending this message. If not specified, defaults to the value of payload. @type request_payload: int or None @param options: The EDNS options @type options: None or list of dns.edns.Option objects @see: RFC 2671 NFr Tr l ~ r )r r r r r! r" )r5 r r r r" r! r r r use_edns s( zMessage.use_ednsc C sL |r*| j dk r| j | jtjjO _n | j dkrH| jtjj M _dS )a Enable or disable 'DNSSEC desired' flag in requests. @param wanted: Is DNSSEC desired? If True, EDNS is enabled if required, and then the DO bit is set. If False, the DO bit is cleared if EDNS is enabled. @type wanted: bool r N)r rm r r r ZDO)r5 Zwantedr r r want_dnssec s zMessage.want_dnssecc C s t jj| j| jS )z.Return the rcode. @rtype: int )r r@ r? r r )r5 r r r r@ s z Message.rcodec C sj t jj|\}}| jdM _| j|O _| jtdM _| j|O _| jdkrf| jdk rfd| _dS )zPSet the rcode. @param rcode: the rcode @type rcode: int i i r N)r r@ to_flagsr r r r )r5 r@ valueZevaluer r r set_rcode" s zMessage.set_rcodec C s t jj| jS )z/Return the opcode. @rtype: int )r r> r? r )r5 r r r r> / s zMessage.opcodec C s( | j dM _ | j tjj|O _ dS )zTSet the opcode. @param opcode: the opcode @type opcode: int i N)r r r> ro )r5 r> r r r set_opcode5 s zMessage.set_opcode)N)NT)Nr )r r rk NN)T)r r r r r6 r9 r; r: rJ rK rM rR r rdatatypeNONEr_ r` re r% r& rj rm rn r@ rq r> rr r r r r r K s0 K 7 - ! .) * r c @ s2 e Zd ZdZd ddZdd Zdd Zd d Zd S ) _WireReadera Wire format reader. @ivar wire: the wire-format message. @type wire: string @ivar message: The message object being built @type message: dns.message.Message object @ivar current: When building a message object from wire format, this variable contains the offset from the beginning of wire of the next octet to be read. @type current: int @ivar updating: Is the message a dynamic update? @type updating: bool @ivar one_rr_per_rrset: Put each RR into its own RRset? @type one_rr_per_rrset: bool @ivar ignore_trailing: Ignore trailing junk at end of request? @type ignore_trailing: bool @ivar zone_rdclass: The class of the zone in messages which are DNS dynamic updates. @type zone_rdclass: int Fc C s@ t jj|| _|| _d| _d| _t jj| _ || _ || _ || _ d S )Nr F) r ZwiredataZ maybe_wrapwiremessagecurrentupdating rdataclassIN zone_rdclass question_onlyone_rr_per_rrsetignore_trailing)r5 rv rw r} r~ r r r r r6 U s z_WireReader.__init__c C s | j r|dkrtjjxtd|D ]}tjj| j| j\}}| j j dk rV|j | j j }| j| | _t j d| j| j| jd \}}| jd | _| j j| j j|||ddd | j r"|| _q"W dS )zRead the next I{qcount} records from the wire data and add them to the question section. @param qcount: the number of questions in the message @type qcount: intr r Nz!HH T)r\ r] )ry r exception FormErrorr rW from_wirerv rx rw r/ rC structunpackr_ r r| )r5 qcountiqnameusedrY rX r r r _get_question` s z_WireReader._get_questionc C sH | j s | jrd}nd}d}x&td|D ]}| j}tjj| j| j\}}|} | jj dk rh|j | jj }| j| | _t j d| j| j| jd \} } } } | jd | _| tj jkrn|| jjk s|rt| | j_| | j_| d@ d? | j_g | j_| j}| }xj|dkrdt j d | j||d \}}|d }tjj|| j||}| jjj| || }|d | }qW d}n| tj jkrH|| jjko||d kst| jjdkrtd | jjj| }|dkrtd | | | j_ tj j | j| j| \| j_ | j_ tj j!| j| |t"t#j# | jj$|| j| | jj%| jj&| jj' | j_%d| j_(n| dk rVd} | j r| tj)j*ksz| tj)j+kr| }| j,} nd}|tj)j*ks|tj)j+kr|| jj-krtj j+}d}n&tj.j| | | j| j| | jj }|j/ }| jj0r| tj j1krd}| jj2||| | ||d|}|dk r4|j3|| | j| | _q(W dS )a/ Read the next I{count} records from the wire data and add them to the specified section. @param section: the section of the message to which to add records @type section: list of dns.rrset.RRset objects @param count: the number of records to read @type count: intTFr Nz!HHIH i rl z!HHr r z"got signed message without keyringzkey '%s' unknown)4ry r~ r rx r rW r rv rw r/ rC r r rs OPTr r r r r r! Zoption_from_wirerV ZTSIGr r# r rS r$ r% Zget_algorithm_and_macr' r- Zvalidateinttimer( r0 r2 r3 r1 rz ANYrt r| r rdatarZ r. ZSOAr_ add)r5 rQ countr] Zseen_optr Zrr_startrW r Z absolute_namerY rX ttlZrdlenrx ZoptslenZotypeZolenoptZsecretr[ rZ rdrF r r r _get_sectionx s z_WireReader._get_sectionc C s t | j}|dk rttjd| jdd \| j_| j_}}}}d| _t j j | jjr\d| _ | j | | jrpdS | j| jj| | j| jj| | j| jj| | j r| j|krt| jjr| jjr| jj r| jjj| j dS )zNRead a wire format DNS message and build a dns.message.Message object. z!HHHHHHNT)lenrv r r r rw r r rx r r> rA ry r r} r r r r r r r2 r0 r1 update)r5 lr ZancountZaucountZadcountr r r read s$ * z_WireReader.readN)FFF)r r r r r6 r r r r r r r ru > s cru r FTc C sP t dd} || _|| _|| _|| _|| _|| _|| _t| | || | } | j | S )a) Convert a DNS wire format message into a message object. @param keyring: The keyring to use if the message is signed. @type keyring: dict @param request_mac: If the message is a response to a TSIG-signed request, I{request_mac} should be set to the MAC of that request. @type request_mac: string @param xfr: Is this message part of a zone transfer? @type xfr: bool @param origin: If the message is part of a zone transfer, I{origin} should be the origin name of the zone. @type origin: dns.name.Name object @param tsig_ctx: The ongoing TSIG context, used when validating zone transfers. @type tsig_ctx: hmac.HMAC object @param multi: Is this message part of a multiple message sequence? @type multi: bool @param first: Is this message standalone, or the first of a multi message sequence? @type first: bool @param question_only: Read only up to the end of the question section? @type question_only: bool @param one_rr_per_rrset: Put each RR into its own RRset @type one_rr_per_rrset: bool @param ignore_trailing: Ignore trailing junk at end of request? @type ignore_trailing: bool @raises ShortHeader: The message is less than 12 octets long. @raises TrailingJunk: There were octets in the message past the end of the proper DNS message. @raises BadEDNS: An OPT record was in the wrong section, or occurred more than once. @raises BadTSIG: A TSIG record was not the last record of the additional data section. @rtype: dns.message.Message objectr )r ) r r# r( r. r/ r0 r2 r3 ru r ) rv r# r( r. r/ r0 r2 r3 r} r~ r mreaderr r r r s ( r c @ s8 e Zd ZdZdd Zdd Zdd Zdd Zd d Zd S ) _TextReadera Text format reader. @ivar tok: the tokenizer @type tok: dns.tokenizer.Tokenizer object @ivar message: The message object being built @type message: dns.message.Message object @ivar updating: Is the message a dynamic update? @type updating: bool @ivar zone_rdclass: The class of the zone in messages which are DNS dynamic updates. @type zone_rdclass: int @ivar last_name: The most recently read name when building a message object from text format. @type last_name: dns.name.Name object c C s. || _ tjj|| _d | _tjj| _d| _ d S )NF) rw r Z tokenizer Tokenizertok last_namerz r{ r| ry )r5 textrw r r r r6 > s z_TextReader.__init__c C s | j j }|j}|dkr*| j j | j_n|dkrx>| j j }|j sT| j j| P | jjt jj |jB | j_q4W t j j | jjrd| _ n&|dkr| j j | j_| jj| jjd> B | j_n|dkr | jjdk rd| j_x| j j }|j s| j j| P | jjt jj|jB | j_qW n|dkrN| j j | j_| jjdk rd| j_nd|d kr| j j }| jjt j jt j j |B | j_n.|d kr| j j }| jjt jj | nt| j j d S ) z5Process one line from the text format header section.r r Tr rl Zeflagsr r r> r@ N)r rS rp Zget_intrw r is_identifierungetr r rh r> rA ry r r Zedns_from_textr Z get_stringro rq r@ r get_eol)r5 rQ tokenZwhatr r r r _header_lineE sR z_TextReader._header_linec C s | j jdd}|j s(tjj|jd| _| j}| j j }|j sHtj j y,tj j|j}| j j }|j srtj j W n: tj j k r tj j Y n t k r tj j }Y nX tjj|j}| jj| jj|||ddd | jr|| _| j j dS )z7Process one line from the text format question section.T) want_leadingN)r\ r] )r rS is_whitespacer rW rh rp r r r SyntaxErrorrz Exceptionr{ rs rw r_ r ry r| r )r5 rQ r rW rX rY r r r _question_lines s. z_TextReader._question_linec C s d}| j jdd}|j s,tjj|jd| _| j}| j j }|j sLtj j y*t |jd}| j j }|j sttj j W n6 tj j k r tj j Y n t k r d}Y nX yPtj j|j}| j j }|j stj j |tj jks|tj jk r|}| j}W n> tj j k r tj j Y n t k r< tj j}Y nX tjj|j}| j j }|j s| j j| tjj||| j d}|j } n d}tjj} | jj||||| |d| j} |dk r| j|| dS )zfProcess one line from the text format answer, authority, or additional data sections. NT)r r )r rS r r rW rh rp r r r r r r rz r rt r| r{ rs is_eol_or_eofr r rZ rw r_ ry r ) r5 rQ r[ r rW r rX rY r rZ rF r r r _rr_line sT z_TextReader._rr_linec C s | j }d}x| jjdd}|j r$P |j r|jj }|dkrF| j }nv|dksV|dkrf| j}| jj }nV|dksv|dkr| j }| jj }n6|dks|d kr| j }| jj }n|d kr| j }| jj }| jj q | jj| || q W dS ) zNRead a text format DNS message and build a dns.message.Message object.NTZHEADERZQUESTIONZZONEra ZPREREQrb ZUPDATErc )r r rS r Z is_commentrp upperr rw r r r r r r r )r5 Z line_methodrQ r ur r r r s4 z_TextReader.readN) r r r r r6 r r r r r r r r r , s . 5r c C s t }t| |}|j |S )zConvert the text format message into a message object. @param text: The text format message. @type text: string @raises UnknownHeaderField: @raises dns.exception.SyntaxError: @rtype: dns.message.Message object)r r r )r r r r r r rh s rh c C sF t }d}t| |r"t| |} d}nd}z t| }W d|r@| j X |S )a Read the next text format message from the specified file. @param f: file or string. If I{f} is a string, it is treated as the name of a file to open. @raises UnknownHeaderField: @raises dns.exception.SyntaxError: @rtype: dns.message.Message objectZrUTFN)r rG openrh close)fZstr_typeZoptsZ want_closer r r r from_file s r c C s t | trtjj| } t |tr,tjj|}t |trBtjj|}t } | jtjj O _| j | j | ||ddd i } |dk r|| d< |dkrd}|dk r|| d< |dkrd}|dk r|| d< |dkrd}|dk r|| d< |dkrd}|| d < | j f | | j | | S ) aV Make a query message. The query name, type, and class may all be specified either as objects of the appropriate type, or as strings. The query will have a randomly chosen query id, and its DNS flags will be set to dns.flags.RD. @param qname: The query name. @type qname: dns.name.Name object or string @param rdtype: The desired rdata type. @type rdtype: int @param rdclass: The desired rdata class; the default is class IN. @type rdclass: int @param use_edns: The EDNS level to use; the default is None (no EDNS). See the description of dns.message.Message.use_edns() for the possible values for use_edns and their meanings. @type use_edns: int or bool or None @param want_dnssec: Should the query indicate that DNSSEC is desired? @type want_dnssec: bool @param ednsflags: EDNS flag values. @type ednsflags: int @param payload: The EDNS sender's payload field, which is the maximum size of UDP datagram the sender can handle. @type payload: int @param request_payload: The EDNS payload size to use when sending this message. If not specified, defaults to the value of payload. @type request_payload: int or None @param options: The EDNS options @type options: None or list of dns.edns.Option objects @see: RFC 2671 @rtype: dns.message.Message objectT)r\ r] Nr r r r" r! r )rG r r rW rh rs rz r r RDr_ r rm rn ) r rY rX rm rn r r r" r! r kwargsr r r make_query s> $ r , c C s | j tj j@ rtjjdtjj| j}tj j| j tj j@ B |_ |rV| j tj j O _ |j | j t | j |_ | jdkr|jdd|| j | jr|j| j| j|ddd| j | j|_|S )a Make a message which is a response for the specified query. The message returned is really a response skeleton; it has all of the infrastructure required of a response, but none of the content. The response's question section is a shallow copy of the query's question section, so the query's question RRsets should not be changed. @param query: the query to respond to @type query: dns.message.Message object @param recursion_available: should RA be set in the response? @type recursion_available: bool @param our_payload: payload size to advertise in EDNS responses; default is 8192. @type our_payload: int @param fudge: TSIG time fudge; default is 300 seconds. @type fudge: int @rtype: dns.message.Message objectz&specified query message is not a queryr Nr )r r rL r r rw r r r ZRArr r> rf r r rm r r1 rj r# r$ r' r- r( )ZqueryZrecursion_availableZ our_payloadr+ Zresponser r r make_response\ s r ) Nr FNNFTFFF)Fr r ).r Z __future__r ior r r Zdns.ednsr Z dns.exceptionZ dns.flagsZdns.nameZ dns.opcodeZ dns.entropyZ dns.rcodeZ dns.rdataZdns.rdataclassZ dns.rdatatypeZ dns.rrsetZ dns.rendererZdns.tsigZ dns.wiredataZ_compatr r r r r r r Z DNSExceptionr r r r objectr ru r r rh r rz r{ r r r r r r <module> sX v 7 5 :F PK g\M ) __pycache__/resolver.cpython-36.opt-1.pycnu [ 3 >DW @ s d Z ddlZddlZddlZddlZy ddlZW n ek rL ddlZY nX ddl Z ddl Z ddl Z ddl Z ddlZ ddlZ ddlZ ddlZ ddlZ ddlZ ddlZ ddlZ ddlmZmZ ejdkry ddlZW n ek r ddlZY nX G dd de j j Z G dd d e j j Z e j j Z G d d d e j j Z!G d d d e j j Z"G dd de j j Z#G dd de j j Z$G dd de j j Z%G dd de&Z'G dd de&Z(G dd de&Z)G dd de&Z*G d d d e&Z+da,d d Z-d d! Z.e j/j0e j1j2d"dd#dfd$d%Z3e j1j2d"dfd&d'Z4ej5ej6gej7ej8giZ9da:ej;Z<ej=Z>ej?Z@ejAZBejCZDejEZFddejGdddfd(d)ZHd8d*d+ZId9d,d-ZJd.d/ ZKd0d1 ZLd2d3 ZMd:d4d5ZNd6d7 ZOdS );z{DNS stub resolver. @var default_resolver: The default resolver object @type default_resolver: dns.resolver.Resolver object N )xrange string_typeswin32c sV e Zd ZdZeddgZdZdddZ fddZd d Z e e d d Z d d Z Z S )NXDOMAINz"The DNS query name does not exist.qnames responsesNc C s\ t |tttfstdt|dkr,td|d kr:i }nt |tsLtdt||d}|S )Nz#qnames must be a list, tuple or setr z(qnames must contain at least one elementz(responses must be a dict(qname=response))r r ) isinstancelisttuplesetAttributeErrorlendict)selfr r kwargs r /usr/lib/python3.6/resolver.py _check_kwargs9 s zNXDOMAIN._check_kwargsc s^ d| j krtt| j S | j d }t|dkr4d}n| jd d }djtt|}d||f S )Nr r z None of DNS query names existz, z%s: %s) r superr __str__r __doc__joinmapstr)r r msg) __class__r r r E s zNXDOMAIN.__str__c C s d| j krtdtjj}tjj}d }xj| j d D ]\}| j d | }x4|jD ]*}|j|ksL|j |krfqL|j d j j }qLW |d k r2tj j|S q2W | j d d S )Nr z parametrized exception requiredr r )r TypeErrordns rdataclassIN rdatatypeCNAMEanswerrdtyperdclassitemstargetto_textname from_text)r r! r# cnameqnameresponser$ r r r canonical_nameP s zNXDOMAIN.canonical_namez%Return the unresolved canonical name.)docc C s| t | jjdg }t| jjdi }|jjdi }x<|jjdg D ]*}||krX|j| ||krB|| ||< qBW t||dS )z3Augment by results from another NXDOMAIN exception.r r )r r )r r getr appendr )r Ze_nxZqnames0Z responses0Z responses1Zqname1r r r __add__b s zNXDOMAIN.__add__)N) __name__ __module__ __qualname__r r supp_kwargsfmtr r r/ propertyr3 __classcell__r r )r r r 3 s r c @ s e Zd ZdZdS )YXDOMAINz8The DNS query name is too long after DNAME substitution.N)r4 r5 r6 r r r r r r; o s r; c s. e Zd ZdZdZedgZ fddZ ZS )NoAnswerz<The DNS response does not contain an answer to the question.z,The DNS response does not contain an answer zto the question: {query}r. c s t t| j|d jdS )Nr. )query)r r< _fmt_kwargsquestion)r r )r r r r> s zNoAnswer._fmt_kwargszDThe DNS response does not contain an answer to the question: {query}) r4 r5 r6 r r8 r r7 r> r: r r )r r r< z s r< c s@ e Zd ZdZdZdedd ZeddgZ fdd Z Z S ) NoNameserverszAll nameservers failed to answer the query. errors: list of servers and respective errors The type of errors is [(server ip address, any object convertible to string)]. Non-empty errors list will add explanatory message () z+All nameservers failed to answer the query.z%s {query}: {errors}Nr requesterrorsc sd g }x>|d D ]2}|j d|d |d r*dnd|d |d f qW tt| j|d jd j|d S ) NrB z Server %s %s port %s answered %sr r ZTCPZUDP rA z; )r= rB )r2 r r@ r> r? r )r r Zsrv_msgserr)r r r r> s & zNoNameservers._fmt_kwargsr ) r4 r5 r6 r r r8 r r7 r> r: r r )r r r@ s r@ c @ s e Zd ZdZdS ) NotAbsolutezEAn absolute domain name is required but a relative name was provided.N)r4 r5 r6 r r r r r rF s rF c @ s e Zd ZdZdS ) NoRootSOAzBThere is no SOA RR at the DNS root name. This should never happen!N)r4 r5 r6 r r r r r rG s rG c @ s e Zd ZdZdS ) NoMetaqueriesz DNS metaqueries are not allowed.N)r4 r5 r6 r r r r r rH s rH c @ sB e Zd ZdZdddZdd Zdd Zd d Zd d Zd d Z dS )Answera9 DNS stub resolver answer Instances of this class bundle up the result of a successful DNS resolution. For convenience, the answer object implements much of the sequence protocol, forwarding to its rrset. E.g. "for a in answer" is equivalent to "for a in answer.rrset", "answer[i]" is equivalent to "answer.rrset[i]", and "answer[i:j]" is equivalent to "answer.rrset[i:j]". Note that CNAMEs or DNAMEs in the response may mean that answer node's name might not be the query name. @ivar qname: The query name @type qname: dns.name.Name object @ivar rdtype: The query type @type rdtype: int @ivar rdclass: The query class @type rdclass: int @ivar response: The response message @type response: dns.message.Message object @ivar rrset: The answer @type rrset: dns.rrset.RRset object @ivar expiration: The time when the answer expires @type expiration: float (seconds since the epoch) @ivar canonical_name: The canonical name of the query name @type canonical_name: dns.name.Name object Tc C s || _ || _|| _|| _d}d }xtddD ]}y0|j|j|||}|dksV|j|k r\|j}P W q, tk r |t j j kryJ|j|j||t j j } |dks| j|k r| j}x| D ] } | j }P qW w,W n" tk r |rt |dY nX | rt |dY q,X q,W |d kr |r t |d|| _|| _|d krxyR|j|j||t j j} |dksf| j|k rl| j}| d j|k r| d j}P W n@ tk r y |j }W n t jjk r P Y nX Y nX q8W tj | | _d S ) Nr r )r. r r r r )r- r% r& r. r Z find_rrsetr$ ttlKeyErrorr r" r# r( r< r/ rrsetZ authoritySOAZminimumparentr* NoParenttime expiration) r r- r% r& r. raise_on_no_answerZmin_ttlrM countZcrrsetZrdZsrrsetr r r __init__ sf zAnswer.__init__c C s\ |dkr| j jS |dkr | j jS |dkr0| j jS |dkr@| j jS |dkrP| j jS t|d S )Nr* rK coversr& r% )rM r* rK rV r& r% r )r attrr r r __getattr__ s zAnswer.__getattr__c C s | j rt| j pdS )Nr )rM r )r r r r __len__ s zAnswer.__len__c C s | j rt| j ptt S )N)rM iterr )r r r r __iter__ s zAnswer.__iter__c C s | j | S )N)rM )r ir r r __getitem__ s zAnswer.__getitem__c C s | j |= d S )N)rM )r r\ r r r __delitem__ s zAnswer.__delitem__N)T) r4 r5 r6 r rU rX rY r[ r] r^ r r r r rI s 7rI c @ s< e Zd ZdZdddZdd Zdd Zd d Zdd d Zd S )Cacheaq Simple DNS answer cache. @ivar data: A dictionary of cached data @type data: dict @ivar cleaning_interval: The number of seconds between cleanings. The default is 300 (5 minutes). @type cleaning_interval: float @ivar next_cleaning: The time the cache should next be cleaned (in seconds since the epoch.) @type next_cleaning: float r@c C s* i | _ || _tj | j | _tj | _dS )zInitialize a DNS cache. @param cleaning_interval: the number of seconds between periodic cleanings. The default is 300.0 @type cleaning_interval: float. N)datacleaning_intervalrQ next_cleaning _threadingLocklock)r rb r r r rU - s zCache.__init__c C sp t j }| j|krlg }x*| jj D ] \}}|j|kr"|j| q"W x|D ] }| j|= qHW t j }|| j | _dS )z&Clean the cache if it's time to do so.N)rQ rc ra r' rR r2 rb )r nowZkeys_to_deletekvr r r _maybe_clean: s zCache._maybe_cleanc C sN z<| j j | j | jj|}|dks6|jtj kr:dS |S | j j X dS )a) Get the answer associated with I{key}. Returns None if no answer is cached for the key. @param key: the key @type key: (dns.name.Name, int, int) tuple whose values are the query name, rdtype, and rdclass. @rtype: dns.resolver.Answer object or None N)rf acquirerj ra r1 rR rQ release)r keyri r r r r1 H s z Cache.getc C s2 z | j j | j || j|< W d| j j X dS )a Associate key and value in the cache. @param key: the key @type key: (dns.name.Name, int, int) tuple whose values are the query name, rdtype, and rdclass. @param value: The answer being cached @type value: dns.resolver.Answer object N)rf rk rj ra rl )r rm valuer r r put[ s z Cache.putNc C sR z@| j j |dk r(|| jkr>| j|= ni | _tj | j | _W d| j j X dS )zFlush the cache. If I{key} is specified, only that item is flushed. Otherwise the entire cache is flushed. @param key: the key to flush @type key: (dns.name.Name, int, int) tuple or None N)rf rk ra rQ rb rc rl )r rm r r r flushk s z Cache.flush)r` )N) r4 r5 r6 r rU rj r1 ro rp r r r r r_ s r_ c @ s0 e Zd ZdZdd Zdd Zdd Zdd Zd S ) LRUCacheNodezLRUCache node. c C s || _ || _| | _| | _d S )N)rm rn prevnext)r rm rn r r r rU s zLRUCacheNode.__init__c C s |j | _ || _| |j _| |_ d S )N)rr rs )r noder r r link_before s zLRUCacheNode.link_beforec C s || _ |j| _| |j_ | |_d S )N)rr rs )r rt r r r link_after s zLRUCacheNode.link_afterc C s | j | j_ | j| j _d S )N)rr rs )r r r r unlink s zLRUCacheNode.unlinkN)r4 r5 r6 r rU ru rv rw r r r r rq s rq c @ s< e Zd ZdZdddZdd Zdd Zd d Zdd d Zd S )LRUCacheaO Bounded least-recently-used DNS answer cache. This cache is better than the simple cache (above) if you're running a web crawler or other process that does a lot of resolutions. The LRUCache has a maximum number of nodes, and when it is full, the least-recently used node is removed to make space for a new one. @ivar data: A dictionary of cached data @type data: dict @ivar sentinel: sentinel node for circular doubly linked list of nodes @type sentinel: LRUCacheNode object @ivar max_size: The maximum number of nodes @type max_size: int 順 c C s* i | _ | j| tdd| _tj | _dS )zInitialize a DNS cache. @param max_size: The maximum number of nodes to cache; the default is 100,000. Must be greater than 1. @type max_size: int N)ra set_max_sizerq sentinelrd re rf )r max_sizer r r rU s zLRUCache.__init__c C s |dk r d}|| _ d S )Nr )r| )r r| r r r rz s zLRUCache.set_max_sizec C sl zZ| j j | jj|}|dkr$dS |j |jjtj krJ| j|j= dS |j | j |jS | j j X dS )a) Get the answer associated with I{key}. Returns None if no answer is cached for the key. @param key: the key @type key: (dns.name.Name, int, int) tuple whose values are the query name, rdtype, and rdclass. @rtype: dns.resolver.Answer object or None N) rf rk ra r1 rw rn rR rQ rm rv r{ rl )r rm rt r r r r1 s z LRUCache.getc C s z| j j | jj|}|dk r2|j | j|j= x.t| j| jkr`| jj }|j | j|j= q4W t ||}|j | j || j|< W d| j j X dS )a Associate key and value in the cache. @param key: the key @type key: (dns.name.Name, int, int) tuple whose values are the query name, rdtype, and rdclass. @param value: The answer being cached @type value: dns.resolver.Answer object N) rf rk ra r1 rw rm r r| r{ rr rq rv rl )r rm rn rt r r r ro s z LRUCache.putNc C s zr| j j |dk r<| jj|}|dk rp|j | j|j= n4| jj}x$|| jkrh|j}d|_d|_|}qFW i | _W d| j j X dS )zFlush the cache. If I{key} is specified, only that item is flushed. Otherwise the entire cache is flushed. @param key: the key to flush @type key: (dns.name.Name, int, int) tuple or None N) rf rk ra r1 rw rm r{ rs rr rl )r rm rt rs r r r rp s zLRUCache.flush)ry )N) r4 r5 r6 r rU rz r1 ro rp r r r r rx s rx c @ s e Zd ZdZd%ddZdd Zdd Zd d Zd d Zdd Z dd Z dd Z dd Z dd Z dd Zejjejjdddd fd d Zdejjfd d Zd!d" Zd#d$ ZdS )&Resolvera- DNS stub resolver @ivar domain: The domain of this host @type domain: dns.name.Name object @ivar nameservers: A list of nameservers to query. Each nameserver is a string which contains the IP address of a nameserver. @type nameservers: list of strings @ivar search: The search list. If the query name is a relative name, the resolver will construct an absolute query name by appending the search names one by one to the query name. @type search: list of dns.name.Name objects @ivar port: The port to which to send queries. The default is 53. @type port: int @ivar timeout: The number of seconds to wait for a response from a server, before timing out. @type timeout: float @ivar lifetime: The total number of seconds to spend trying to get an answer to the question. If the lifetime expires, a Timeout exception will occur. @type lifetime: float @ivar keyring: The TSIG keyring to use. The default is None. @type keyring: dict @ivar keyname: The TSIG keyname to use. The default is None. @type keyname: dns.name.Name object @ivar keyalgorithm: The TSIG key algorithm to use. The default is dns.tsig.default_algorithm. @type keyalgorithm: string @ivar edns: The EDNS level to use. The default is -1, no Edns. @type edns: int @ivar ednsflags: The EDNS flags @type ednsflags: int @ivar payload: The EDNS payload size. The default is 0. @type payload: int @ivar flags: The message flags to use. The default is None (i.e. not overwritten) @type flags: int @ivar cache: The cache to use. The default is None. @type cache: dns.resolver.Cache object @ivar retry_servfail: should we retry a nameserver if it says SERVFAIL? The default is 'false'. @type retry_servfail: bool /etc/resolv.confTc C s d| _ d| _d| _d| _d| _d| _d| _d| _d| _d| _ d| _ d| _ d| _ d| _ d| _d| _d| _| j |rtjdkr| j n|r| j| dS )aJ Initialize a resolver instance. @param filename: The filename of a configuration file in standard /etc/resolv.conf format. This parameter is meaningful only when I{configure} is true and the platform is POSIX. @type filename: string or file object @param configure: If True (the default), the resolver instance is configured in the normal fashion for the operating system the resolver is running on. (I.e. a /etc/resolv.conf file on POSIX systems and from the registry on Windows systems.) @type configure: boolNFr )domain nameserversnameserver_portsportsearchtimeoutlifetimekeyringkeyname keyalgorithmedns ednsflagspayloadcacheflagsretry_servfailrotateresetsysplatform read_registryread_resolv_conf)r filenameZ configurer r r rU 9 s. zResolver.__init__c C s t jjt jjtj dd | _t| jdkr:t jj| _g | _ i | _ d| _ g | _ d| _ d| _d| _d| _t jj| _d| _d| _d| _d| _d| _d| _d| _dS ) z1Reset all resolver configuration to the defaults.r Nr 5 g @g >@Fr )r r* Namer+ socket gethostnamer r rootr r r r r r r r tsigdefault_algorithmr r r r r r r r )r r r r r _ s& " zResolver.resetc C sZ t |tr<yt|d}W n tk r4 dg| _dS X d}nd}zx|D ]}t|dksH|d dksH|d dkrrqH|j }t|d k rqH|d d kr| jj|d qH|d d krtj j |d | _ qH|d d kr xL|d d D ]}| j jtj j | qW qH|d dkrHd|d d krHd| _ qHW W d|r8|j X t| jdkrV| jjd dS )zProcess f as a file in the /etc/resolv.conf format. If f is a string, it is used as the name of the file to open; otherwise it is treated as the file itself.rz 127.0.0.1NTFr #;rC nameserverr r r Zoptionsr )r r openIOErrorr r splitr2 r r* r+ r r r close)r fZ want_closeltokenssuffixr r r r v s: $ zResolver.read_resolv_confc C s0 |j ddkrd}n|j ddkr(d}nd}|S )N r ,)find)r entry split_charr r r _determine_split_char s z Resolver._determine_split_charc C sD t |}| j|}|j|}x"|D ]}|| jkr"| jj| q"W dS )z&Configure a NameServer registry entry.N)r r r r r2 )r r r Zns_listnsr r r _config_win32_nameservers s z"Resolver._config_win32_nameserversc C s t jjt|| _dS )z"Configure a Domain registry entry.N)r r* r+ r r )r r r r r _config_win32_domain s z Resolver._config_win32_domainc C sL t |}| j|}|j|}x*|D ]"}|| jkr"| jjtjj| q"W dS )z"Configure a Search registry entry.N)r r r r r2 r r* r+ )r r r Z search_listsr r r _config_win32_search s z Resolver._config_win32_searchc # C s. yt j|d\}}W n tk r, d}Y nX |rv| j| y"t j|d\}}|r\| j| W q tk rr Y qX ntyt j|d\}}W n tk r d}Y nX |r| j| y"t j|d\}}|r| j| W n tk r Y nX yt j|d\}}W n tk r d}Y nX |r*| j| dS )z%Extract DNS info from a registry key.Z NameServerNZDomainZDhcpNameServerZ DhcpDomainZ SearchList)_winreg QueryValueEx WindowsErrorr r r )r rm ZserversZrtypeZdomr r r r _config_win32_fromkey s< z Resolver._config_win32_fromkeyc , C s t jdt j}d}zyt j|d}d}W n tk rH t j|d}Y nX z| j| W d|j X |rt j|d}ztd}xjyNt j||}|d7 }t j||}| j|||sw|z| j| W d|j X W q| tk r P Y q|X q|W W d|j X W d|j X dS ) z9Extract resolver configuration from the Windows registry.NFz2SYSTEM\CurrentControlSet\Services\Tcpip\ParametersTz+SYSTEM\CurrentControlSet\Services\VxD\MSTCPz=SYSTEM\CurrentControlSet\Services\Tcpip\Parameters\Interfacesr r ) r ZConnectRegistryHKEY_LOCAL_MACHINEOpenKeyEnvironmentErrorr CloseZEnumKey_win32_is_nic_enabled)r lmZ want_scanZ tcp_paramsZ interfacesr\ guidrm r r r r s@ zResolver.read_registryc C s yt j|d| }zft j|d\}}|t jkr2tt j|d| }z(t j|d\}}|t jkrbt|d@ S |j X W d |j X W nF ttfk r yt j|d\} }| d k S tk r dS X Y nX d S )Nz]SYSTEM\CurrentControlSet\Control\Network\{4D36E972-E325-11CE-BFC1-08002BE10318}\%s\ConnectionZ PnpInstanceIDz SYSTEM\CurrentControlSet\Enum\%sZ ConfigFlagsr ZNTEContextListF) r r r ZREG_SZ ValueErrorZ REG_DWORDr r r ) r r r Z interface_keyZconnection_keyZpnp_idZttypeZ device_keyr Znter r r r s6 z Resolver._win32_is_nic_enabledc C sV t j }|| }|dk r0|dk r,t|dn|}|| jkrDt|dt| j| | jS )Nr r )r r )rQ Timeoutr minr )r startrg Zdurationr r r _compute_timeoutM s zResolver._compute_timeoutFNr c C s t |trtjj|d}t |tr.tjj|}tjj|r>tt |trTtjj|}tjj |rdtg }|j r||j | nZt |dkr|j |j tjj | jrx2| jD ]} |j |j | qW n|j |j | j d} i } tj } d} x|D ]} | jr@| jj| ||f}|dk r@|jdkr<|r<t|jdn|S tjj| ||}| jdk rr|j| j| j| j d |j | j | j | j | j!dk r| j!|_!d}| j"dd }g }| j#rt$j%| d}x|dkrt |dkrt&||dx`|dd D ]N}| j'| }| j(j|| j)}yx|}|rDtj*j+||||||d }nNtj*j,||||||d }|j!tj!j-@ rd}| j'| }tj*j+||||||d }W n t.j/tj0j1fk r } z"|j |||||f d}wW Y dd}~X n tj*j2k r" } z"|j |||||f d}wW Y dd}~X n tj0j3k rn } z,|j4| |j |||||f d}wW Y dd}~X nJ t5k r } z,|j4| |j |||||f d}wW Y dd}~X nX |j6 }|tj6j7krt7 }|j |||||f ||tj6j8ks|tj6j9kr P |tj6j:ks"| j; r,|j4| |j |||tj6j<||f d}qW |dk r^P t |dkr| j'| }t=||}|d 9 }tj>| qW |j6 tj6j9kr|| | < qd } P qW | rt9|| d t?| ||||}| jr| jj@| ||f| |S ) a Query nameservers to find the answer to the question. The I{qname}, I{rdtype}, and I{rdclass} parameters may be objects of the appropriate type, or strings that can be converted into objects of the appropriate type. E.g. For I{rdtype} the integer 2 and the the string 'NS' both mean to query for records with DNS rdata type NS. @param qname: the query name @type qname: dns.name.Name object or string @param rdtype: the query type @type rdtype: int or string @param rdclass: the query class @type rdclass: int or string @param tcp: use TCP to make the query (default is False). @type tcp: bool @param source: bind to this IP address (defaults to machine default IP). @type source: IP address in dotted quad notation @param raise_on_no_answer: raise NoAnswer if there's no answer (defaults is True). @type raise_on_no_answer: bool @param source_port: The port from which to send the message. The default is 0. @type source_port: int @rtype: dns.resolver.Answer instance @raises Timeout: no answers could be found in the specified lifetime @raises NXDOMAIN: the query name does not exist @raises YXDOMAIN: the query name is too long after DNAME substitution @raises NoAnswer: the response did not contain an answer and raise_on_no_answer is True. @raises NoNameservers: no non-broken nameservers are available to answer the question.Nr T)r. ) algorithmg?r )rA rB )source source_portrC F)r r )Ar r r r* r+ r" Z is_metatyperH r Z is_metaclass is_absoluter2 r Z concatenater r r rQ r r1 rM r< r. messageZ make_queryr use_tsigr r use_ednsr r r r r r randomZshuffler@ r r r r= tcpudpZTCr error exceptionr ZUnexpectedSourceZ FormErrorremoveEOFErrorrcoder; ZNOERRORr ZSERVFAILr r) r ZsleeprI ro )r r- r% r& r r rS r Z qnames_to_tryr Z all_nxdomainZnxdomain_responsesr Z_qnamer$ rA r. r rB Zbackoffr r r Z tcp_attemptZexr Z sleep_timer r r r= ] s # zResolver.queryc C s4 || _ |dkr$t| j j d | _n|| _|| _dS )a Add a TSIG signature to the query. @param keyring: The TSIG keyring to use; defaults to None. @type keyring: dict @param keyname: The name of the TSIG key to use; defaults to None. The key must be defined in the keyring. If a keyring is specified but a keyname is not, then the key used will be the first key in the keyring. Note that the order of keys in a dictionary is not defined, so applications should supply a keyname when a keyring is used, unless they know the keyring contains only one key. @param algorithm: The TSIG key algorithm to use. The default is dns.tsig.default_algorithm. @type algorithm: stringNr )r r keysr r )r r r r r r r r " s zResolver.use_tsigc C s" |dkr d}|| _ || _|| _dS )a Configure Edns. @param edns: The EDNS level to use. The default is -1, no Edns. @type edns: int @param ednsflags: The EDNS flags @type ednsflags: int @param payload: The EDNS payload size. The default is 0. @type payload: intNr r )r r r )r r r r r r r r 8 s zResolver.use_ednsc C s || _ dS )zOverrides the default flags with your own @param flags: The flags to overwrite the default with @type flags: intN)r )r r r r r set_flagsH s zResolver.set_flags)r~ T)r4 r5 r6 r rU r r r r r r r r r r r r" Ar r! r= r r r r r r r r r r} s& + &) "-7 Er} c C s t dkrt t S )z7Get the default resolver, initializing it if necessary.N)default_resolverreset_default_resolverr r r r get_default_resolverR s r c C s t adS )zSRe-initialize default resolver. resolv.conf will be re-read immediatelly. N)r} r r r r r r Y s r FTc C s t j| ||||||S )zQuery nameservers to find the answer to the question. This is a convenience function that uses the default resolver object to make the query. @see: L{dns.resolver.Resolver.query} for more information on the parameters.)r r= )r- r% r& r r rS r r r r r= b s r= c C s t | tr tjj| tjj} |dkr*t }| j s:t| xxy(|j | tj j ||}|j j| krb| S W n tj jtj jfk r Y nX y | j } W q< tjjk r tY q<X q<W dS )a Find the name of the zone which contains the specified name. @param name: the query name @type name: absolute dns.name.Name object or string @param rdclass: The query class @type rdclass: int @param tcp: use TCP to make the query (default is False). @type tcp: bool @param resolver: the resolver to use @type resolver: dns.resolver.Resolver object or None @rtype: dns.name.NameN)r r r r* r+ r r r rF r= r" rN rM resolverr r< rO rP rG )r* r& r r r$ r r r zone_for_nameo s" r c , C s |t jt jB @ dkrt| d kr4|d kr4t jt jg }g }d }y| d krd}|t j@ dkrr|jd |jd q|jd |jd n>| jd} t | dkr| d } n| } t j j | } |j| | }W np t k r: y t jj | } |j| | }W n8 t k r4 |t j@ dkr0y|t jks8|t jkrtj| t jjd d } | j} | jjd }| jd k rx | jD ]} |j| j qrW |t jks|t jkrtj| t jj d d }|j} |jjd }|jd k rx |jD ]} |j| j qW W n< t j j k r t jt jY n t jt j Y nX Y nX Y nX d }y |d krRd}nt |}W nL t k r |t j!@ dkryt j"|}W n t k r Y nX Y nX |d krt jt jg }|dkrt j#t j$g}n|g}|t j%@ dkr|}nd }|t jks|t jkrfxP|D ]H} x@|D ]8}x0t&| D ]$}|jt j|||| |ddff q2W q$W qW |t jks~|t jkrxL|D ]D} x<|D ]4}x,t&| D ] }|jt j|||| |ff qW qW qW t |dkrt jt j|S ) Nr Z localhostz::z0.0.0.0z::1z 127.0.0.1%rC F)rS T )'r Z AI_ADDRCONFIGZ AI_V4MAPPEDNotImplementedErrorgaierror EAI_NONAMEZ AI_PASSIVEr2 r r r ipv6 inet_aton ExceptionZipv4ZAI_NUMERICHOSTAF_INET6 AF_UNSPEC _resolverr= r" ZAAAAr- r/ r) rM ZaddressAF_INETr r r Z EAI_SYSTEMintZAI_NUMERICSERVZ getservbyname SOCK_DGRAM SOCK_STREAM AI_CANONNAME_protocols_for_socktype)hostservicefamilyZsocktypeprotor Zv6addrsZv4addrsr/ partsZahostaddrZv6ZrdataZv4r tuplesZ socktypesr, r r r _getaddrinfo s $ r c C sf | d }| d }t | dkr,| d }tj}n d }tj}t|||tjtjd}t |dkrbtjd|d d d }|tj@ rd}nd}t j j |} |tj @ dkr y"t j| d} | jd jjd } W nV t jjt jjfk r |tj@ rtjtj|} |d k r| d t| 7 } Y nX n |} |d k r<| d t| 7 } |tj@ rRt|} n tj||} | | fS ) Nr r rD z'sockaddr resolved to multiple addressesr r ZPTRTr )r r r r r r SOL_TCPr ZNI_DGRAMr Z reversenameZ from_addressZNI_NUMERICHOSTr r= rM r( r) r r r< NI_NAMEREQDr r r ZNI_NUMERICSERVZ getservbyport) sockaddrr r r Zscoper r r Zpnamer- r$ Zhostnamer r r r _getnameinfo sB r c C sD | d krt j } ytt| dd d d S tk r> | S X d S )NP r r )r r r r r )r* r r r _getfqdn. s r c C s t | d d S )NrC r )_gethostbyname_ex)r* r r r _gethostbyname7 s r c C sX g }g }t | dtjtjtjtj}|d d }x |D ]}|j|d d q4W |||fS )Nr rD r )r r r r r r r2 )r* aliases addressesr canonicalitemr r r r ; s r c C s y"t jj| | dddf}tj}W n" tk rD | df}tj}Y nX t|tj\}}g }g }t |d|tj tj tj }|d d }x |D ]} |j | d d qW |||fS )Nr r rD r )r r r r r r r r r r r r r r2 ) Zipr r r* r r r r r r r r r _gethostbyaddrG s r c C s: | dkrt } | att_tt_tt_t t_ t t_ t t_dS )a Override the system resolver routines in the socket module with versions which use dnspython's resolver. This can be useful in testing situations where you want to control the resolution behavior of python code without having to change the system's resolver settings (e.g. /etc/resolv.conf). The resolver to use may be specified; if it's not, the default resolver will be used. @param resolver: the resolver to use @type resolver: dns.resolver.Resolver object or None N)r r r r getaddrinfor getnameinfor getfqdnr gethostbynamer gethostbyname_exr gethostbyaddr)r r r r override_system_resolver[ s r c C s, da tt_tt_tt_tt_ t t_ t t_ dS )z4Undo the effects of override_system_resolver(). N)r _original_getaddrinfor r _original_getnameinfor _original_getfqdnr _original_gethostbynamer _original_gethostbyname_exr _original_gethostbyaddrr r r r r restore_system_resolveru s r )r )N)N)Pr r r rQ r Z threadingrd ImportErrorZdummy_threadingZ dns.exceptionr Z dns.flagsZdns.ipv4Zdns.ipv6Z dns.messageZdns.nameZ dns.queryZ dns.rcodeZdns.rdataclassZ dns.rdatatypeZdns.reversenameZdns.tsigZ_compatr r r winregr r Z DNSExceptionr r; r r< r@ rF rG rH objectrI r_ rq rx r} r r r r" r r r! r= r r ZSOL_UDPr r r r r r r r r r r r r r r r r r r r r r r r r r r r r <module> s < sb o G & c ( PK g\JaA A % __pycache__/tsig.cpython-36.opt-1.pycnu [ 3 bW& @ s~ d Z ddlZddlZddlZddlZddlZddlZddlm Z m Z m Z G dd dej j ZG dd dej j ZG d d d ej j ZG d d d eZG d d deZG dd deZG dd deZejjdZejjdZejjdZejjdZejjdZejjdZ ededede d ed ed iZ eZ d Z d Z d!Z!d"Z"dd#d$e fd%d&Z#dd#d$e fd'd(Z$d/d)d*Z%d+d, Z&d-d. Z'dS )0zDNS TSIG support. N )long string_types text_typec @ s e Zd ZdZdS )BadTimez8The current time is not within the TSIG's validity time.N)__name__ __module__ __qualname____doc__ r r /usr/lib/python3.6/tsig.pyr s r c @ s e Zd ZdZdS ) BadSignaturez#The TSIG signature fails to verify.N)r r r r r r r r r s r c @ s e Zd ZdZdS ) PeerErrorz;Base class for all TSIG errors generated by the remote peerN)r r r r r r r r r % s r c @ s e Zd ZdZdS ) PeerBadKeyz$The peer didn't know the key we usedN)r r r r r r r r r * s r c @ s e Zd ZdZdS )PeerBadSignaturez*The peer didn't like the signature we sentN)r r r r r r r r r / s r c @ s e Zd ZdZdS ) PeerBadTimez%The peer didn't like the time we sentN)r r r r r r r r r 4 s r c @ s e Zd ZdZdS )PeerBadTruncationz=The peer didn't like amount of truncation in the TSIG we sentN)r r r r r r r r r 9 s r zHMAC-MD5.SIG-ALG.REG.INTz hmac-sha1z hmac-sha224z hmac-sha256z hmac-sha384z hmac-sha512ZSHA224ZSHA256ZSHA384ZSHA512ZSHA1ZMD5 FTc C s t |tr|j }t| \} }| r\tj||d} t|}|dkr\| jtj d| | j| tj d|}| j| | j| dd | r| j|j | jtj dt j j | jtj dd |td }|d? td@ }|td @ }tj d |||}| | }t|}|dkrtd tj d ||| }| rF| j| | j| n | j| | j }tj dt|}|| | | | }| rtj||d} t|}| jtj d| | j| nd} ||| fS ) aj Return a (tsig_rdata, mac, ctx) tuple containing the HMAC TSIG rdata for the input parameters, the HMAC MAC calculated by applying the TSIG signature algorithm, and the TSIG digest context. @rtype: (string, string, hmac.HMAC object) @raises ValueError: I{other_data} is too long @raises NotImplementedError: I{algorithm} is not supported ) digestmodr z!H Nz!I i l z!HIHz TSIG Other Data is > 65535 bytesz!HH) isinstancer encode get_algorithmhmacnewlenupdatestructpack to_digestablednsZ rdataclassANYr ValueErrorZdigest)wirekeynamesecrettimefudge original_iderror other_data request_macctxmultifirst algorithmZalgorithm_namer ZmlidZ long_time upper_time lower_timeZtime_macZpre_macZolZpost_macmacZmpack tsig_rdatar r r signW sN r9 c C s t | ||||||||| | | | S )N)r9 ) r' r( r) r* r+ r, r- r. r/ r0 r1 r2 r3 r r r hmac_md5 s r: c C s t jd| dd \} | dkr&tjj| d8 } | dd t jd| | d| } |} tjj| | \}}| | } t jd| | | d \}}}}|td d> |td }| d7 } | | | | }| |7 } t jd| | | d \}}}| d 7 } | | | | }| |7 } | || kr tjj|dkrv|t kr:t n<|t krJt n,|t krZtn |tkrjtn td | || }|| }||k s||krtt| |||||||||| | | \} } }| |krt|S ) a* Validate the specified TSIG rdata against the other input parameters. @raises FormError: The TSIG is badly formed. @raises BadTime: There is too much time skew between the client and the server. @raises BadSignature: The TSIG signature did not validate @rtype: hmac.HMAC objectz!H r r z!HIHHr z!HHH zunknown TSIG error code %d)r! unpackr$ exception FormErrorr" name from_wirer BADSIGr BADKEYr BADTIMEr BADTRUNCr r r r9 r ) r' r( r) Znowr/ Z tsig_startr8 tsig_rdlenr0 r1 r2 ZadcountZnew_wirecurrentanameusedr5 r6 r+ mac_sizer* r7 r, r- Z other_sizer. Ztime_lowZ time_highZjunkZour_macr r r validate sN $ rL c C s\ t | trtjj| } y| j tjjt| fS t k rV t dt | d Y nX dS )zReturns the wire format string and the hash module to use for the specified TSIG algorithm @rtype: (string, hash constructor) @raises NotImplementedError: I{algorithm} is not supported zTSIG algorithm z is not supportedN) r r r$ rA from_textr# hashZhashes_hashesKeyErrorNotImplementedErrorstr)r3 r r r r s r c C sz |}t jj| |\}}|| }tjd| ||d \}}}} |d7 }| ||| } || 7 }||| krrt jj|| fS )zlReturn the tsig algorithm for the specified tsig_rdata @raises FormError: The TSIG is badly formed. z!HIHHr; )r$ rA rB r! r> r? r@ ) r' r8 rG rH rI rJ r5 r6 r+ rK r7 r r r get_algorithm_and_mac s rS )NFT)(r r r! Z dns.exceptionr$ Zdns.hashZdns.rdataclassZdns.nameZ_compatr r r r? Z DNSExceptionr r r r r r r rA rM ZHMAC_MD5Z HMAC_SHA1Z HMAC_SHA224Z HMAC_SHA256Z HMAC_SHA384Z HMAC_SHA512rO Zdefault_algorithmrC rD rE rF r9 r: rL r rS r r r r <module> sL 5 5PK g\ȟ __pycache__/ipv6.cpython-36.pycnu [ 3 bW @ s d Z ddlZddlZddlZddlZddlmZmZm Z ej dZ dd Z ej dZ ej d Zej d Zd d ZdZdd ZdS )zIPv6 helper functions. N )xrange binary_type maybe_decodes 0+([0-9a-f]+)c C s t | dkrtdtj| }g }d}t |}xJ||k rx|||d }tj|}|dk rd|jd}|j| |d7 }q0W d}d}d} d} xNtdD ]B}|| d kr| r|} | | } | |kr| }| }d} q| s|} d } qW | rd} | | } | |k r| }| }|dkr|dkrb|d ks4|d krb|d d krb|d krDd} nd} | t j j | dd }n,dj |d| d dj ||| d }n dj |}t |S )zConvert a network format IPv6 address into text. @param address: the binary address @type address: string @rtype: string @raises ValueError: the address isn't 16 bytes long z IPv6 addresses are 16 bytes longr Nr F 0T s ffffs ::s ::ffff: :)len ValueErrorbinasciiZhexlify _leading_zeromatchgroupappendr dnsipv4 inet_ntoajoinr )addresshexchunksilchunkmZ best_startZbest_lenstartZ last_was_zeroendZ current_lenprefix r$ /usr/lib/python3.6/ipv6.pyr s^ r s (.*):(\d+\.\d+\.\d+\.\d+)$s ::.*s .*::$c C s t | ts| j } | dkr d} tj| }|dk rvttjj|j d}d|j dj |d |d |d |d f j } t j| }|dk r| dd } n t j| }|dk r| dd } | j d }t|}|d krtjjd }g }x|D ]}|d kr.|r tjjd }xftdd | d D ]}|jd qW qt|} | dkrHtjj| dkrbdd| | }|j| qW |d k r| rtjjd j|} y tj| S tjtfk r tjjY nX dS )zConvert a text format IPv6 address into network format. @param text: the textual address @type text: string @rtype: string @raises dns.exception.SyntaxError: the text was not properly formatted s ::s 0::N z%s:%02x%02x:%02x%02xr r r r F Ts 0000r r r ) isinstancer encode _v4_endingr bytearrayr r inet_atonr decode_colon_colon_start_colon_colon_endsplitr Z exception SyntaxErrorr r r r Z unhexlifyError TypeError) textr br r Z seen_emptyZ canonicalcr Zlcr$ r$ r% r- b sR r- s c C s | j tS )N) startswith_mapped_prefix)r r$ r$ r% is_mapped s r< s s )__doc__rer Z dns.exceptionr Zdns.ipv4Z_compatr r r compiler r r+ r/ r0 r- r; r< r$ r$ r$ r% <module> s C GPK g\8Yw w __pycache__/rrset.cpython-36.pycnu [ 3 $Wk @ sl d Z ddlZddlZddlZddlZddlmZ G dd dejj Z dddZ d d Z dd d Z d d ZdS )z)DNS RRsets (an RRset is a named rdataset) N ) string_typesc s e Zd ZdZddgZejjdf fdd Z fddZ d d Z d d Z fd dZ d fdd Z d fdd Zd fdd Zdd Z ZS )RRseta6 A DNS RRset (named rdataset). RRset inherits from Rdataset, and RRsets can be treated as Rdatasets in most cases. There are, however, a few notable exceptions. RRsets have different to_wire() and to_text() method arguments, reflecting the fact that RRsets always have an owner name. namedeletingNc s$ t t| j||| || _|| _dS )zCreate a new RRset.N)superr __init__r r )selfr rdclassrdtypecoversr ) __class__ /usr/lib/python3.6/rrset.pyr ' s zRRset.__init__c s" t t| j }| j|_| j|_|S )N)r r _cloner r )r obj)r r r r / s z RRset._clonec C s | j dkrd}ndtjj| j d }| jd k rDdtjj| j }nd}dt| j d tjj| j d tjj| j | | d S ) Nr ()z delete=z<DNS z RRset>) r dns rdatatypeto_textr rdataclassstrr r r )r ZctextZdtextr r r __repr__5 s zRRset.__repr__c C s | j S )N)r )r r r r __str__B s z RRset.__str__c s. t |tsdS | j|jkr dS tt| j|S )zcTwo RRsets are equal if they have the same name and the same rdataset @rtype: boolF) isinstancer r r __eq__)r other)r r r r E s z RRset.__eq__c s4 t t| j|||sdS | j|ks,| j|kr0dS dS )zaReturns True if this rrset matches the specified class, type, covers, and deletion state.FT)r r matchr r )r r r r r r )r r r r P s z RRset.matchTc s t t| j| j||| jf|S )a Convert the RRset into DNS master file format. @see: L{dns.name.Name.choose_relativity} for more information on how I{origin} and I{relativize} determine the way names are emitted. Any additional keyword arguments are passed on to the rdata to_text() method. @param origin: The origin for relative names, or None. @type origin: dns.name.Name object @param relativize: True if names should names be relativized @type relativize: bool)r r r r r )r originZ relativizekw)r r r r Z s z RRset.to_textc s t t| j| j|||| jf|S )z!Convert the RRset to wire format.)r r to_wirer r )r filecompressr! r" )r r r r# l s z RRset.to_wirec C s t jj| jt| S )zYConvert an RRset into an Rdataset. @rtype: dns.rdataset.Rdataset object )r rdatasetfrom_rdata_listttllist)r r r r to_rdatasetr s zRRset.to_rdataset)N)NT)NN)__name__ __module__ __qualname____doc__ __slots__r r ZNONEr r r r r r r r# r* __classcell__r r )r r r s r c C s t | tr tjj| d|d} t |tr2tjj|}t |trHtjj|}t| ||}|j| x*|D ]"}tj j|j |j |}|j | qdW |S )zCreate an RRset with the specified name, TTL, class, and type, and with the specified list of rdatas in text format. @rtype: dns.rrset.RRset object N) idna_codec) r r r r from_textr r r update_ttlZrdatar r add) r r( r r text_rdatasr1 rtrdr r r from_text_listz s r9 c G s t | ||||S )zCreate an RRset with the specified name, TTL, class, and type and with the specified rdatas in text format. @rtype: dns.rrset.RRset object )r9 )r r( r r r5 r r r r2 s r2 c C sr t | tr tjj| d|d} t|dkr0tdd}x8|D ]0}|dkr`t| |j|j }|j | |j | q:W |S )zCreate an RRset with the specified name and TTL, and with the specified list of rdata objects. @rtype: dns.rrset.RRset object N)r1 r z rdata list must not be empty) r r r r r2 len ValueErrorr r r r3 r4 )r r( rdatasr1 r6 r8 r r r r' s r' c G s t | ||S )zCreate an RRset with the specified name and TTL, and with the specified rdata objects. @rtype: dns.rrset.RRset object )r' )r r( r< r r r from_rdata s r= )N)N)r. Zdns.namer Z dns.rdatasetZdns.rdataclassZ dns.rendererZ_compatr r& ZRdatasetr r9 r2 r' r= r r r r <module> s a PK g\0 __pycache__/node.cpython-36.pycnu [ 3 bW @ s< d Z ddlmZ ddlZddlZddlZG dd deZdS )z)DNS nodes. A node is a set of rdatasets. )StringIONc @ s e Zd ZdZdgZdd Zdd Zdd Zd d Zd d Z d d Z dd Z e j jdfddZe j jdfddZe j jfddZdd ZdS )NodezA DNS node. A node is a set of rdatasets @ivar rdatasets: the node's rdatasets @type rdatasets: list of dns.rdataset.Rdataset objects rdatasetsc C s g | _ dS )z Initialize a DNS node. N)r )self r /usr/lib/python3.6/node.py__init__$ s z Node.__init__c K sP t }x8| jD ].}t|dkr|j|j|f| |jd qW |j dd S )a+ Convert a node to text format. Each rdataset at the node is printed. Any keyword arguments to this method are passed on to the rdataset's to_text() method. @param name: the owner name of the rdatasets @type name: dns.name.Name object @rtype: string r N )r r lenwriteto_textgetvalue)r namekwsrdsr r r r * s z Node.to_textc C s dt t| d S )Nz <DNS node >)strid)r r r r __repr__; s z Node.__repr__c C s@ x | j D ]}||j krdS qW x |j D ]}|| j kr&dS q&W dS )zSTwo nodes are equal if they have the same rdatasets. @rtype: bool FT)r )r otherZrdr r r __eq__> s z Node.__eq__c C s | j | S )N)r )r r r r r __ne__N s z Node.__ne__c C s t | jS )N)r r )r r r r __len__Q s z Node.__len__c C s t | jS )N)iterr )r r r r __iter__T s z Node.__iter__Fc C sH x | j D ]}|j|||r|S qW |s*ttjj||}| j j| |S )a Find an rdataset matching the specified properties in the current node. @param rdclass: The class of the rdataset @type rdclass: int @param rdtype: The type of the rdataset @type rdtype: int @param covers: The covered type. Usually this value is dns.rdatatype.NONE, but if the rdtype is dns.rdatatype.SIG or dns.rdatatype.RRSIG, then the covers value will be the rdata type the SIG/RRSIG covers. The library treats the SIG and RRSIG types as if they were a family of types, e.g. RRSIG(A), RRSIG(NS), RRSIG(SOA). This makes RRSIGs much easier to work with than if RRSIGs covering different rdata types were aggregated into a single RRSIG rdataset. @type covers: int @param create: If True, create the rdataset if it is not found. @type create: bool @raises KeyError: An rdataset of the desired type and class does not exist and I{create} is not True. @rtype: dns.rdataset.Rdataset object )r matchKeyErrordnsrdatasetRdatasetappend)r rdclassrdtypecoverscreater r r r find_rdatasetW s zNode.find_rdatasetc C s2 y| j ||||}W n tk r, d}Y nX |S )aE Get an rdataset matching the specified properties in the current node. None is returned if an rdataset of the specified type and class does not exist and I{create} is not True. @param rdclass: The class of the rdataset @type rdclass: int @param rdtype: The type of the rdataset @type rdtype: int @param covers: The covered type. @type covers: int @param create: If True, create the rdataset if it is not found. @type create: bool @rtype: dns.rdataset.Rdataset object or None N)r( r )r r$ r% r& r' r r r r get_rdatasety s zNode.get_rdatasetc C s& | j |||}|dk r"| jj| dS )az Delete the rdataset matching the specified properties in the current node. If a matching rdataset does not exist, it is not an error. @param rdclass: The class of the rdataset @type rdclass: int @param rdtype: The type of the rdataset @type rdtype: int @param covers: The covered type. @type covers: int N)r) r remove)r r$ r% r& r r r r delete_rdataset s zNode.delete_rdatasetc C s: t |tjjstd| j|j|j|j | j j | dS )a8 Replace an rdataset. It is not an error if there is no rdataset matching I{replacement}. Ownership of the I{replacement} object is transferred to the node; in other words, this method does not store a copy of I{replacement} at the node, it stores I{replacement} itself. z replacement is not an rdatasetN) isinstancer r! r" ValueErrorr+ r$ r% r& r r# )r Z replacementr r r replace_rdataset s zNode.replace_rdatasetN)__name__ __module__ __qualname____doc__ __slots__r r r r r r r r Z rdatatypeZNONEr( r) r+ r. r r r r r s ! r ) r2 ior Z dns.rdatasetr Z dns.rdatatypeZ dns.rendererobjectr r r r r <module> s PK g\])z z & __pycache__/flags.cpython-36.opt-1.pycnu [ 3 bWh @ s d Z dZdZdZdZdZdZdZdZeeeeeeedZ d eiZ e d d e j D Z e d d e j D Zd d Zee ZeeZdd Zdd Zdd Zdd Zdd Zdd ZdS ) zDNS Message Flags.i i i )QRAATCRDRAADCDDOc c s | ]\}}||fV qd S )N ).0xyr r /usr/lib/python3.6/flags.py <genexpr>3 s r c c s | ]\}}||fV qd S )Nr )r r r r r r r 5 s c C s t | j }|j |j |S )N)listitemssortreverse)tableorderr r r _order_flags8 s r c C s. d}| j }x |D ]}|||j B }qW |S )N )splitupper)textr flagstokenstr r r _from_textC s r! c C s6 g }x&|D ] \}}| |@ dkr |j | q W dj|S )Nr )appendjoin)r r r Z text_flagskvr r r _to_textK s r' c C s t | tS )zZConvert a space-separated list of flag text values into a flags value. @rtype: int)r! _by_text)r r r r from_textS s r) c C s t | ttS )z]Convert a flags value into a space-separated list of flag text values. @rtype: string)r' _by_value _flags_order)r r r r to_text[ s r, c C s t | tS )zdConvert a space-separated list of EDNS flag text values into a EDNS flags value. @rtype: int)r! _edns_by_text)r r r r edns_from_textc s r. c C s t | ttS )zhConvert an EDNS flags value into a space-separated list of EDNS flag text values. @rtype: string)r' _edns_by_value_edns_flags_order)r r r r edns_to_textk s r1 N)__doc__r r r r r r r r r( r- dictr r* r/ r r+ r0 r! r' r) r, r. r1 r r r r <module> s6 PK g\{_ __pycache__/set.cpython-36.pycnu [ 3 bW# @ s d Z G dd deZdS )zA simple Set class.c @ s e Zd ZdZdgZdDddZdd Zdd Zd d Zd d Z dd Z dd Z dd Z dd Z dd Zdd Zdd Zd d Zd d Zd d! Zd"d# Zd$d% Zd&d' Zd(d) Zd*d+ Zd,d- Zd.d/ Zd0d1 Zd2d3 Z d4d5 Z d6d7 Z d8d9 Z d:d; Z d<d= Z!d>d? Z"d@dA Z#dBdC Z$dS )ESeta' A simple set class. Sets are not in Python until 2.3, and rdata are not immutable so we cannot use sets.Set anyway. This class implements subset of the 2.3 Set interface using a list as the container. @ivar items: A list of the items which are in the set @type items: listitemsNc C s* g | _ |dk r&x|D ]}| j| qW dS )zvInitialize the set. @param items: the initial set of items @type items: any iterable or None N)r add)selfr item r /usr/lib/python3.6/set.py__init__ s z Set.__init__c C s dt | j S )Nzdns.simpleset.Set(%s))reprr )r r r r __repr__, s z Set.__repr__c C s || j kr| j j| dS )zAdd an item to the set.N)r append)r r r r r r / s zSet.addc C s | j j| dS )z Remove an item from the set.N)r remove)r r r r r r 4 s z Set.removec C s* y| j j| W n tk r$ Y nX dS )z'Remove an item from the set if present.N)r r ValueError)r r r r r discard8 s z Set.discardc C s | j }|j|}t| j|_|S )a Make a (shallow) copy of the set. There is a 'clone protocol' that subclasses of this class should use. To make a copy, first call your super's _clone() method, and use the object returned as the new instance. Then make shallow copies of the attributes defined in the subclass. This protocol allows us to write the set algorithms that return new instances (e.g. union) once, and keep using them in subclasses. ) __class____new__listr )r clsobjr r r _clone? s z Set._clonec C s | j S )z!Make a (shallow) copy of the set.)r )r r r r __copy__Q s z Set.__copy__c C s | j S )z!Make a (shallow) copy of the set.)r )r r r r copyU s zSet.copyc C s< t |tstd| |kr dS x|jD ]}| j| q&W dS )zUpdate the set, adding any elements from other which are not already in the set. @param other: the collection of items with which to update the set @type other: Set object z other must be a Set instanceN) isinstancer r r r )r otherr r r r union_updateY s zSet.union_updatec C sL t |tstd| |kr dS x(t| jD ]}||jkr*| jj| q*W dS )zUpdate the set, removing any elements from other which are not in both sets. @param other: the collection of items with which to update the set @type other: Set object z other must be a Set instanceN)r r r r r r )r r r r r r intersection_updatef s zSet.intersection_updatec C s@ t |tstd| |kr"g | _nx|jD ]}| j| q*W dS )zUpdate the set, removing any elements from other which are in the set. @param other: the collection of items with which to update the set @type other: Set object z other must be a Set instanceN)r r r r r )r r r r r r difference_updatev s zSet.difference_updatec C s | j }|j| |S )zReturn a new set which is the union of I{self} and I{other}. @param other: the other set @type other: Set object @rtype: the same type as I{self} )r r )r r r r r r union s z Set.unionc C s | j }|j| |S )zReturn a new set which is the intersection of I{self} and I{other}. @param other: the other set @type other: Set object @rtype: the same type as I{self} )r r )r r r r r r intersection s zSet.intersectionc C s | j }|j| |S )zReturn a new set which I{self} - I{other}, i.e. the items in I{self} which are not also in I{other}. @param other: the other set @type other: Set object @rtype: the same type as I{self} )r r )r r r r r r difference s zSet.differencec C s | j |S )N)r )r r r r r __or__ s z Set.__or__c C s | j |S )N)r )r r r r r __and__ s z Set.__and__c C s | j |S )N)r )r r r r r __add__ s z Set.__add__c C s | j |S )N)r )r r r r r __sub__ s z Set.__sub__c C s | j | | S )N)r )r r r r r __ior__ s z Set.__ior__c C s | j | | S )N)r )r r r r r __iand__ s z Set.__iand__c C s | j | | S )N)r )r r r r r __iadd__ s z Set.__iadd__c C s | j | | S )N)r )r r r r r __isub__ s z Set.__isub__c C s x|D ]}| j | qW dS )zUpdate the set, adding any elements from other which are not already in the set. @param other: the collection of items with which to update the set @type other: any iterable typeN)r )r r r r r r update s z Set.updatec C s g | _ dS )zMake the set empty.N)r )r r r r clear s z Set.clearc C s@ x | j D ]}||j krdS qW x |j D ]}|| j kr&dS q&W dS )NFT)r )r r r r r r __eq__ s z Set.__eq__c C s | j | S )N)r) )r r r r r __ne__ s z Set.__ne__c C s t | jS )N)lenr )r r r r __len__ s z Set.__len__c C s t | jS )N)iterr )r r r r __iter__ s z Set.__iter__c C s | j | S )N)r )r ir r r __getitem__ s zSet.__getitem__c C s | j |= d S )N)r )r r/ r r r __delitem__ s zSet.__delitem__c C s4 t |tstdx | jD ]}||jkrdS qW dS )z?Is I{self} a subset of I{other}? @rtype: bool z other must be a Set instanceFT)r r r r )r r r r r r issubset s z Set.issubsetc C s4 t |tstdx |jD ]}|| jkrdS qW dS )zAIs I{self} a superset of I{other}? @rtype: bool z other must be a Set instanceFT)r r r r )r r r r r r issuperset s zSet.issuperset)N)%__name__ __module__ __qualname____doc__ __slots__r r r r r r r r r r r r r r r r r! r" r# r$ r% r& r' r( r) r* r, r. r0 r1 r2 r3 r r r r r sD r N)r7 objectr r r r r <module> s PK g\bCI " __pycache__/_compat.cpython-36.pycnu [ 3 bW! @ s d dl Z d dlZd dlmZ e jd kr0eZeZneZeZe jd krfeZ e Z efZ e Zdd Zdd Zn"eZ eZ efZ eZdd Zd d Zd d ZdS ) N)Context c C s | j S )N)decode)x r /usr/lib/python3.6/_compat.py maybe_decode s r c C s | j S )N)encode)r r r r maybe_encode s r c C s | S )Nr )r r r r r s c C s | S )Nr )r r r r r s c C s, t ttt| tjdjt| }t|S )z Python 2 and Python 3 use different rounding strategies in round(). This function ensures that results are python2/3 compatible and backward compatible with previous py2 releases :param what: float :return: rounded long )ZprecZrounding)r lenstrlongdecimalZ ROUND_HALF_UPZcreate_decimal)Zwhatdr r r round_py2_compat# s r )r )r )sysr r version_infointr rangeZxranger Z text_typebytesZ binary_typeZ string_typeschrZunichrr r ZunicodeZ basestringr r r r r <module> s* PK g\M( ( $ __pycache__/ttl.cpython-36.opt-1.pycnu [ 3 bW @ s8 d Z ddlZddlmZ G dd dejjZdd ZdS ) zDNS TTL conversion. N )longc @ s e Zd ZdZdS )BadTTLz!DNS TTL value is not well-formed.N)__name__ __module__ __qualname____doc__ r r /usr/lib/python3.6/ttl.pyr s r c C s* | j rt| }n| d j s"ttd}td}x| D ]}|j rZ|d9 }|t|7 }q8|j }|dkr|||td 7 }nl|dkr||td 7 }nR|dkr||td 7 }n8|d kr||td 7 }n |d kr||7 }n td | d}q8W |dkstd |tdk s |tdkr&td|S )zConvert the text form of a TTL to an integer. The BIND 8 units syntax for TTLs (e.g. '1w6d4h3m10s') is supported. @param text: the textual TTL @type text: string @raises dns.ttl.BadTTL: the TTL is not well-formed @rtype: int r wi: diQ hi m< szunknown unit '%s'ztrailing integeriz0TTL should be between 0 and 2^31 - 1 (inclusive))isdigitr r lower)textZtotalZcurrentcr r r from_text s8 r ) r Z dns.exceptionZdnsZ_compatr Z exception SyntaxErrorr r r r r r <module> s PK g\]5 5 & __pycache__/query.cpython-36.opt-1.pycnu [ 3 OfL @ s d Z ddlmZ ddlZddlZddlZddlZddlZddlZddl Z ddl Z ddl Z ddl Z ddlZ ddlZ ddlmZmZ ejd/kreZnejZejZG dd de jjZG d d d e jjZ d d Z d d Z dd Z dd Z dd Z!e"edre a#ne a#dd Z$dd Z%dd Z&d d Z'd d Z(d0d"d#Z)d$d% Z*d&d' Z+d(d) Z,d1d*d+Z-e j.j/e j0j1dd ddd,dddddd!e j2j3fd-d.Z4dS )2zTalk to a DNS server. ) generatorsN )long string_types c @ s e Zd ZdZdS )UnexpectedSourcez=A DNS query response came from an unexpected address or port.N)__name__ __module__ __qualname____doc__ r r /usr/lib/python3.6/query.pyr , s r c @ s e Zd ZdZdS ) BadResponsez<A DNS query response does not respond to the question asked.N)r r r r r r r r r 1 s r c C s | d kr d S t j | S d S )N)time)timeoutr r r _compute_expiration6 s r c C sj d}|r|t jO }|r |t jO }|r.|t jO }t j }|j| | |rZ|jt|d }n|j }t|S )aq Poll polling backend. @param fd: File descriptor @type fd: int @param readable: Whether to wait for readability @type readable: bool @param writable: Whether to wait for writability @type writable: bool @param timeout: Deadline timeout (expiration time, in seconds) @type timeout: float @return True on success, False on timeout r i )selectZPOLLINZPOLLOUTZPOLLERRpollregisterr bool)fdreadablewritableerrorr Z event_maskZpollableZ event_listr r r _poll_for= s r c C sr g g g }}}|r| g}|r$| g}|r.| g}|dkrLt j |||\}} } nt j ||||\}} } t|pn| pn| S )as Select polling backend. @param fd: File descriptor @type fd: int @param readable: Whether to wait for readability @type readable: bool @param writable: Whether to wait for writability @type writable: bool @param timeout: Deadline timeout (expiration time, in seconds) @type timeout: float @return True on success, False on timeout N)r r ) r r r r r ZrsetZwsetZxsetZrcountZwcountZxcountr r r _select_for\ s r c C s d}x|s|d krd }n |t j }|dkr4tjjy t| ||||sNtjjW n6 tk r } z|jd tjkrv|W Y d d }~X nX d}qW d S )NFg r T) r dns exceptionZTimeout_polling_backend select_errorargserrnoZEINTR)r r r r expirationdoner er r r _wait_fory s r% c C s | a dS )z# Internal API. Do not use. N)r )fnr r r _set_polling_backend s r' r c C s t | ddd| d S )NTF)r% )sr" r r r _wait_for_readable s r) c C s t | ddd| d S )NFT)r% )r( r" r r r _wait_for_writable s r* c C sD t jj| |d }t jj| |d }||koB|dd |dd kS )Nr r )r inetZ inet_pton)afZa1Za2Zn1Zn2r r r _addresses_equal s r- c C s` |sdS t | ||s<tjj|d r@|dd |dd kr@dS |rHdS td| d| d S )NTr r Fzgot a response from z instead of )r- r r+ Z is_multicastr )r, from_address destinationignore_unexpectedr r r _matches_destination s (r1 c C s | d kr6yt jj|} W n tk r4 t jj} Y nX | t jjkrp||f}|d k sZ|dkr|d krfd}||f}n@| t jjkr||ddf}|d k s|dkr|d krd}||ddf}| ||fS )Nr z0.0.0.0z::)r r+ Zaf_for_address ExceptionZAF_INETZAF_INET6)r, whereportsource source_portr/ r r r _destination_and_source s$ r7 5 Fc C s" | j } t|||||\}} }t|tjd} d} zt|}| jd |dk rV| j| t| | t j } | j | | xt | | | j d\} }t | j|| |sqvt j | }y"tjj| | j| j|d}||_ W n tk r | rwvn Y nX | j| r|S | rqvqvtqvW W d| j X dS )a Return the response obtained after sending a query via UDP. @param q: the query @type q: dns.message.Message @param where: where to send the message @type where: string containing an IPv4 or IPv6 address @param timeout: The number of seconds to wait before the query times out. If None, the default, wait forever. @type timeout: float @param port: The port to which to send the message. The default is 53. @type port: int @param af: the address family to use. The default is None, which causes the address family to use to be inferred from the form of where. If the inference attempt fails, AF_INET is used. @type af: int @rtype: dns.message.Message object @param source: source address. The default is the wildcard address. @type source: string @param source_port: The port from which to send the message. The default is 0. @type source_port: int @param ignore_unexpected: If True, ignore responses from unexpected sources. The default is False. @type ignore_unexpected: bool @param one_rr_per_rrset: Put each RR into its own RRset @type one_rr_per_rrset: bool r Ni )keyring request_macone_rr_per_rrset)to_wirer7 socket_factorysocket SOCK_DGRAMr setblockingbindr* r Zsendtor) recvfromr1 Zfamilyr message from_wirer9 macr2 is_responser close)qr3 r r4 r, r5 r6 r0 r; ignore_errorswirer/ r( begin_timer" r. response_timerr r r udp sD rN c C sJ d}x@|dkrDt | | | j|}|dkr.t|t| }|| }qW |S )zRead the specified number of bytes from sock. Keep trying until we either get the desired amount, or we hit EOF. A Timeout exception will be raised if the operation is not completed by the expiration time. r )r) ZrecvEOFErrorlen)sockcountr" r( nr r r _net_read s rU c C s> d}t |}x,||k r8t| | || j||d 7 }qW dS )zWrite the specified data to the socket. A Timeout exception will be raised if the operation is not completed by the expiration time. r N)rQ r* send)rR datar" Zcurrentlr r r _net_write/ s rY c C sp y| j | W n\ tjk rj tj d d \}}t|drF|j}n|d }|tjtjtj gkrf|Y nX d S )N r! r ) Zconnectr> r sysexc_infohasattrr! Z EINPROGRESSZ EWOULDBLOCKZEALREADY)r( ZaddressZtyvZv_errr r r _connect; s r_ c C s | j }t|||||\}} }t|tjd} d} zt|} | jd tj } |dk r^| j| t | | t |} t j d| | }t | || t| d| }t jd|\} t| | | }W d| dkrd}n tj | }| j X tjj|| j| j|d}||_| j|st|S )a Return the response obtained after sending a query via TCP. @param q: the query @type q: dns.message.Message object @param where: where to send the message @type where: string containing an IPv4 or IPv6 address @param timeout: The number of seconds to wait before the query times out. If None, the default, wait forever. @type timeout: float @param port: The port to which to send the message. The default is 53. @type port: int @param af: the address family to use. The default is None, which causes the address family to use to be inferred from the form of where. If the inference attempt fails, AF_INET is used. @type af: int @rtype: dns.message.Message object @param source: source address. The default is the wildcard address. @type source: string @param source_port: The port from which to send the message. The default is 0. @type source_port: int @param one_rr_per_rrset: Put each RR into its own RRset @type one_rr_per_rrset: bool r Nz!HrZ )r9 r: r; )r< r7 r= r> SOCK_STREAMr r@ r rA r_ rQ structpackrY rU unpackrG r rC rD r9 rE rF r )rH r3 r r4 r, r5 r6 r; rJ r/ r( rK r" rX tcpmsgldatarL rM r r r tcpI s8 rf Tc & c s t |trtjj|}t |tr,tjj|}tjj|||}|tjjkrltj j|dddd| }|j j | |dk r|j |||d |j }t| | || | \} }} |r|tjjkrtdt| tjd}nt| tjd}|jd | dk r|j| t| }t|| t|}|r*t|| |j| n tj d|| }t ||| d }d }d }d}|rj|} tjj } nd} |} d} d } x6|st|} | dks|dk r| |kr|} |rt || |j d \}}!n&t!|d | }"tj"d|"\}t!||| }|tjjk}#tjj#||j$|j%d | | d | |#d }$|$j&} d } d}%|dkr|$j' sV|$j'd j| krbtj(j)d|$j'd }|j*tjj+krtj(j)dd}%|j, }|tjjkr|d j-| krd }nd }x|$j'|%d D ]}|rtj(j)d|j*tjj+krl|j| krl|r&|d j-| kr tj(j)dd }n|tjjkr:| }||kr~|tjj.ksf|tjjkr~|r~d }n|rtjj.}d }qW |r|j$r|$j/ rtj(j)d|$V q~W |j0 dS )a Return a generator for the responses to a zone transfer. @param where: where to send the message @type where: string containing an IPv4 or IPv6 address @param zone: The name of the zone to transfer @type zone: dns.name.Name object or string @param rdtype: The type of zone transfer. The default is dns.rdatatype.AXFR. @type rdtype: int or string @param rdclass: The class of the zone transfer. The default is dns.rdataclass.IN. @type rdclass: int or string @param timeout: The number of seconds to wait for each response message. If None, the default, wait forever. @type timeout: float @param port: The port to which to send the message. The default is 53. @type port: int @param keyring: The TSIG keyring to use @type keyring: dict @param keyname: The name of the TSIG key to use @type keyname: dns.name.Name object or string @param relativize: If True, all names in the zone will be relativized to the zone origin. It is essential that the relativize setting matches the one specified to dns.zone.from_xfr(). @type relativize: bool @param af: the address family to use. The default is None, which causes the address family to use to be inferred from the form of where. If the inference attempt fails, AF_INET is used. @type af: int @param lifetime: The total number of seconds to spend doing the transfer. If None, the default, then there is no limit on the time the transfer may take. @type lifetime: float @rtype: generator of dns.message.Message objects. @param source: source address. The default is the wildcard address. @type source: string @param source_port: The port from which to send the message. The default is 0. @type source_port: int @param serial: The SOA serial number to use as the base for an IXFR diff sequence (only meaningful if rdtype == dns.rdatatype.IXFR). @type serial: int @param use_udp: Use UDP (only meaningful for IXFR) @type use_udp: bool @param keyalgorithm: The TSIG algorithm to use; defaults to dns.tsig.default_algorithm @type keyalgorithm: string r INSOAz. . %u 0 0 0 0N) algorithmzcannot do a UDP AXFRz!HFTi rZ )r9 r: xfrorigintsig_ctxZmultifirstr; z No answer or RRset not for qnamezfirst RRset is not an SOAr zanswers after final SOAzIXFR base serial mismatchz missing TSIG)1 isinstancer r nameZ from_text rdatatyperC Z make_queryZIXFRrrsetZ authorityappendZuse_tsigr< r7 ValueErrorr= r> r? r` r@ rA r r_ rQ r* rV ra rb rY emptyr) rB rU rc rD r9 rE rl Zanswerr FormErrorrdtyperh copyserialAXFRZhad_tsigrG )&r3 Zzonerv Zrdclassr r4 r9 ZkeynameZ relativizer, Zlifetimer5 r6 rx Zuse_udpZ keyalgorithmrH rq rJ r/ r( r" rX rd r# Z delete_modeZ expecting_SOAZ soa_rrsetrk Zonamerl rm Z mexpirationr. re Zis_ixfrrM Z answer_indexr r r rj s 5 rj )r )Nr8 NNr FFF)Nr8 NNr F)5r Z __future__r r! r r> ra r[ r Z dns.exceptionr Zdns.inetZdns.nameZ dns.messageZdns.rdataclassZ dns.rdatatypeZ_compatr r version_infoOSErrorr r r= r Z DNSExceptionr ru r r r r r% r' r] r r) r* r- r1 r7 rN rU rY r_ rf rp ry Z rdataclassrg ZtsigZdefault_algorithmrj r r r r <module> sX I ? PK g\0q q * __pycache__/exception.cpython-36.opt-1.pycnu [ 3 dW @ sh d Z G dd deZG dd deZG dd deZG dd deZG d d d eZG d d d eZd S )zCommon DNS Exceptions.c sR e Zd ZdZdZe ZdZ fddZdd Z dd Z d d Z fd d Z Z S ) DNSExceptiona Abstract base class shared by all dnspython exceptions. It supports two basic modes of operation: a) Old/compatible mode is used if __init__ was called with empty **kwargs. In compatible mode all *args are passed to standard Python Exception class as before and all *args are printed by standard __str__ implementation. Class variable msg (or doc string if msg is None) is returned from str() if *args is empty. b) New/parametrized mode is used if __init__ was called with non-empty **kwargs. In the new mode *args has to be empty and all kwargs has to exactly match set in class variable self.supp_kwargs. All kwargs are stored inside self.kwargs and used in new __str__ implementation to construct formatted message based on self.fmt string. In the simplest case it is enough to override supp_kwargs and fmt class variables to get nice parametrized messages. Nc sp | j || |r*| jf || _t| | _nt | _| jd krD| j| _|rZtt| j | ntt| j | j d S )N) _check_params _check_kwargskwargsstrmsgdict__doc__superr __init__)selfargsr ) __class__ /usr/lib/python3.6/exception.pyr . s zDNSException.__init__c O s |s|rdS )zsOld exceptions supported only args and not kwargs. For sanity we do not allow to mix old and new behavior.Nr )r r r r r r r = s zDNSException._check_paramsc K s |r|S )Nr )r r r r r r E s zDNSException._check_kwargsc K sh i }x^|j D ]R\}}t|ttfrXttt|||< t|| dkr`|| j ||< q|||< qW |S )zFormat kwargs before printing them. Resulting dictionary has to have keys necessary for str.format call on fmt class variable. )items isinstancelistsetmapr lenpop)r r fmtargskwdatar r r _fmt_kwargsL s zDNSException._fmt_kwargsc s: | j r(| jr(| jf | j }| jjf |S tt| j S d S )N)r fmtr formatr r __str__)r r )r r r r ^ s zDNSException.__str__)__name__ __module__ __qualname__r r r supp_kwargsr r r r r r __classcell__r r )r r r s r c @ s e Zd ZdZdS ) FormErrorzDNS message is malformed.N)r r r! r r r r r r$ h s r$ c @ s e Zd ZdZdS ) SyntaxErrorzText input is malformed.N)r r r! r r r r r r% m s r% c @ s e Zd ZdZdS ) UnexpectedEndz Text input ended unexpectedly.N)r r r! r r r r r r& r s r& c @ s e Zd ZdZdS )TooBigzThe DNS message is too big.N)r r r! r r r r r r' w s r' c @ s e Zd ZdZedgZdZdS )Timeoutz The DNS operation timed out.Ztimeoutz3The DNS operation timed out after {timeout} secondsN)r r r! r r r" r r r r r r( | s r( N)r Exceptionr r$ r% r& r' r( r r r r <module> s UPK g\A ! __pycache__/opcode.cpython-36.pycnu [ 3 bW @ s d Z ddlZdZdZdZdZdZeeeeedZe dd ej D Z G d d d ej j Zd d Zdd Zdd Zdd Zdd ZdS )z DNS Opcodes. N )QUERYIQUERYSTATUSNOTIFYUPDATEc c s | ]\}}||fV qd S )N ).0xyr r /usr/lib/python3.6/opcode.py <genexpr>& s r c @ s e Zd ZdZdS ) UnknownOpcodezAn DNS opcode is unknown.N)__name__ __module__ __qualname____doc__r r r r r ) s r c C sB | j r$t| }|dkr$|dkr$|S tj| j }|dkr>t|S )zConvert text into an opcode. @param text: the textual opcode @type text: string @raises UnknownOpcode: the opcode is unknown @rtype: int r N)isdigitint_by_textgetupperr )textvaluer r r from_text. s r c C s | d@ d? S )zUExtract an opcode from DNS message flags. @param flags: int @rtype: int i x r )flagsr r r from_flagsA s r! c C s | d> d@ S )z`Convert an opcode to a value suitable for ORing into DNS message flags. @rtype: int r i x r )r r r r to_flagsK s r" c C s t j| }|dkrt| }|S )zConvert an opcode to text. @param value: the opcdoe @type value: int @raises UnknownOpcode: the opcode is unknown @rtype: string N) _by_valuer str)r r r r r to_textT s r% c C s t | tkS )znTrue if the opcode in flags is UPDATE. @param flags: DNS flags @type flags: int @rtype: bool )r! r )r r r r is_updatec s r& )r Z dns.exceptionZdnsr r r r r r dictitemsr# Z exceptionZ DNSExceptionr r r! r" r% r& r r r r <module> s$ PK g\YZ 8 8 __pycache__/rdata.cpython-36.pycnu [ 3 bW: @ s d Z ddlmZ ddlZddlZddlZddlZddlZddl Zddl Zddl Zddl m Z mZmZ dZefddZdZefd d Zed Zd d Zdd ZG dd deZG dd deZi ZdZ dd Z d ddZ d ddZ dS ) a DNS rdata. @var _rdata_modules: A dictionary mapping a (rdclass, rdtype) tuple to the module which implements that type. @type _rdata_modules: dict @var _module_prefix: The prefix to use when forming modules names. The default is 'dns.rdtypes'. Changing this value will break the library. @type _module_prefix: string @var _hex_chunk: At most this many octets that will be represented in each chunk of hexstring that _hexify() produces before whitespace occurs. @type _hex_chunk: int )BytesION )xrange string_types text_type c s4 t j| dj fddtdt D j S )a Convert a binary string into its hex encoding, broken up into chunks of I{chunksize} characters separated by a space. @param data: the binary string @type data: string @param chunksize: the chunk size. Default is L{dns.rdata._hex_chunksize} @rtype: string c s g | ]}|| qS r ).0i) chunksizeliner /usr/lib/python3.6/rdata.py <listcomp>6 s z_hexify.<locals>.<listcomp>r )binasciiZhexlifyjoinrangelendecode)datar r )r r r _hexify+ s r c s4 t j| dj fddtdt D j S )a$ Convert a binary string into its base64 encoding, broken up into chunks of I{chunksize} characters separated by a space. @param data: the binary string @type data: string @param chunksize: the chunk size. Default is L{dns.rdata._base64_chunksize} @rtype: string r c s g | ]}|| qS r r )r r )r r r r r I s z _base64ify.<locals>.<listcomp>r )base64Z b64encoder r r r )r r r )r r r _base64ify= s r s "\c C s~ t | tr| j } t | ts$t| } d}xP| D ]H}|tkrL|dt| 7 }q.|dkrj|dk rj|t|7 }q.|d| 7 }q.W |S )zEscape the characters in a quoted string which need it. @param qstring: the string @type qstring: string @returns: the escaped string @rtype: string \r z\%03d) isinstancer encode bytearray __escapedchr)Zqstringtextcr r r _escapifyO s r# c C sF x8t t| d ddD ] }| | dkr| d|d S qW | dd S )zDetermine the index of greatest byte that isn't all zeros, and return the bitmap that contains all the bytes less than that index. @param what: a string of octets representing a bitmap. @type what: string @rtype: string r r r$ )r r )Zwhatr r r r _truncate_bitmaph s r% c @ s e Zd ZdZddgZdd Zdd Zdd Zd.d d Zd/ddZ d0ddZ dd Z dd Z dd Z dd Zdd Zd d Zd d Zd d! Zd"d# Zd$d% Zd&d' Zed1d(d)Zed2d*d+Zd3d,d-Zd S )4Rdataz(Base class for all DNS rdata types. rdclassrdtypec C s || _ || _dS )zInitialize an rdata. @param rdclass: The rdata class @type rdclass: int @param rdtype: The rdata type @type rdtype: int N)r' r( )selfr' r( r r r __init__~ s zRdata.__init__c C s t jjS )a_ DNS SIG/RRSIG rdatas apply to a specific type; this type is returned by the covers() function. If the rdata type is not SIG or RRSIG, dns.rdatatype.NONE is returned. This is useful when creating rdatasets, allowing the rdataset to contain only RRSIGs of a particular type, e.g. RRSIG(NS). @rtype: int )dns rdatatypeNONE)r) r r r covers s z Rdata.coversc C s | j d> | jB S )zReturn a 32-bit type value, the least significant 16 bits of which are the ordinary DNS type, and the upper 16 bits of which are the "covered" type, if any. @rtype: int )r. r( )r) r r r extended_rdatatype s zRdata.extended_rdatatypeNTc K s t dS )z@Convert an rdata to text format. @rtype: string N)NotImplementedError)r) origin relativizekwr r r to_text s z Rdata.to_textc C s t dS )z@Convert an rdata to wire format. @rtype: string N)r1 )r) filecompressr2 r r r to_wire s z Rdata.to_wirec C s t }| j|d| |j S )zlConvert rdata to a format suitable for digesting in hashes. This is also the DNSSEC canonical form.N)r r8 getvalue)r) r2 fr r r to_digestable s zRdata.to_digestablec C s t jj| j| j| j dS )zCheck that the current contents of the rdata's fields are valid. If you change an rdata by assigning to its fields, it is a good idea to call validate() when you are done making changes. N)r+ rdata from_textr' r( r5 )r) r r r validate s zRdata.validatec C sf | j }|tjjkrd}ndtjj| d }dtjj| j d tjj| j | d t| d S )Nr ()z<DNS z rdata: >) r. r+ r, r- r5 rdataclassr' r( str)r) r. Zctextr r r __repr__ s zRdata.__repr__c C s | j S )N)r5 )r) r r r __str__ s z Rdata.__str__c C s8 | j tjj}|j tjj}||kr(dS ||kr4dS dS )zCompare an rdata with another rdata of the same rdtype and rdclass. Return < 0 if self < other in the DNSSEC ordering, 0 if self == other, and > 0 if self > other. r r r$ )r; r+ nameroot)r) otherZourZtheirr r r _cmp s z Rdata._cmpc C s8 t |tsdS | j|jks&| j|jkr*dS | j|dkS )NFr )r r& r' r( rJ )r) rI r r r __eq__ s z Rdata.__eq__c C s8 t |tsdS | j|jks&| j|jkr*dS | j|dkS )NTr )r r& r' r( rJ )r) rI r r r __ne__ s z Rdata.__ne__c C s6 t |t s$| j|jks$| j|jkr(tS | j|dk S )Nr )r r& r' r( NotImplementedrJ )r) rI r r r __lt__ s z Rdata.__lt__c C s6 t |t s$| j|jks$| j|jkr(tS | j|dkS )Nr )r r& r' r( rM rJ )r) rI r r r __le__ s z Rdata.__le__c C s6 t |t s$| j|jks$| j|jkr(tS | j|dkS )Nr )r r& r' r( rM rJ )r) rI r r r __ge__ s z Rdata.__ge__c C s6 t |t s$| j|jks$| j|jkr(tS | j|dkS )Nr )r r& r' r( rM rJ )r) rI r r r __gt__ s z Rdata.__gt__c C s t | jtjjS )N)hashr; r+ rG rH )r) r r r __hash__ s zRdata.__hash__c C s t dS )a Build an rdata object from text format. @param rdclass: The rdata class @type rdclass: int @param rdtype: The rdata type @type rdtype: int @param tok: The tokenizer @type tok: dns.tokenizer.Tokenizer @param origin: The origin to use for relative names @type origin: dns.name.Name @param relativize: should names be relativized? @type relativize: bool @rtype: dns.rdata.Rdata instance N)r1 )clsr' r( tokr2 r3 r r r r= s zRdata.from_textc C s t dS )a< Build an rdata object from wire format @param rdclass: The rdata class @type rdclass: int @param rdtype: The rdata type @type rdtype: int @param wire: The wire-format message @type wire: string @param current: The offset in wire of the beginning of the rdata. @type current: int @param rdlen: The length of the wire-format rdata @type rdlen: int @param origin: The origin to use for relative names @type origin: dns.name.Name @rtype: dns.rdata.Rdata instance N)r1 )rT r' r( wirecurrentrdlenr2 r r r from_wire s zRdata.from_wirec C s dS )zWConvert any domain names in the rdata to the specified relativization. Nr )r) r2 r3 r r r choose_relativity& s zRdata.choose_relativity)NT)NN)N)NT)N)NT)__name__ __module__ __qualname____doc__ __slots__r* r. r0 r5 r8 r; r> rE rF rJ rK rL rN rO rP rQ rS classmethodr= rY rZ r r r r r& w s0 r& c sV e Zd ZdZdgZ fddZdddZedd d Zdd d Z edd dZ Z S ) GenericRdatazGenerate Rdata Class This class is used for rdata types for which we have no better implementation. It implements the DNS "unknown RRs" scheme. r c s t t| j|| || _d S )N)superra r* r )r) r' r( r ) __class__r r r* 8 s zGenericRdata.__init__NTc K s dt | j t| j S )Nz\# %d )r r r )r) r2 r3 r4 r r r r5 < s zGenericRdata.to_textc C s |j }|j s |jdkr(tjjd|j }g }x&|j }|j rHP |j|jj q6W dj |} t j | } t | |krtjjd| ||| S )Nz\#z$generic rdata does not start with \# z'generic rdata hex data has wrong length)get is_identifiervaluer+ Z exception SyntaxErrorZget_intZ is_eol_or_eofappendr r r Z unhexlifyr ) rT r' r( rU r2 r3 tokenZlengthZchunkshexr r r r r= ? s" zGenericRdata.from_textc C s |j | j d S )N)writer )r) r6 r7 r2 r r r r8 S s zGenericRdata.to_wirec C s | |||||| S )Nr )rT r' r( rV rW rX r2 r r r rY V s zGenericRdata.from_wire)NT)NT)NN)N) r[ r\ r] r^ r_ r* r5 r` r= r8 rY __classcell__r r )rc r ra . s ra z dns.rdtypesc C s dd }t j| |f}tjj| }tjj|}|jdd}|st jtjj|f}|sy$|djt ||g}|t | |f< W nV t k r y(|djt d|g}|t tjj|f< W n t k r d }Y nX Y nX |rt ||}nt }|S )Nc S s6 t | }| jd}x |dd D ]}t||}q W |S )N.r ) __import__splitgetattr)rG modZ componentscompr r r import_module` s z&get_rdata_class.<locals>.import_module-_rn ANY) _rdata_modulesre r+ rC r5 r, replacerw r _module_prefix ImportErrorrq ra )r' r( rt rr Z rdclass_textZ rdtype_textrT r r r get_rdata_class^ s. r| Tc C s t |trtjj|}t| |}|tkrx|j }|j| |j rx|j dkrxtj | ||||}t | ||j dt|j |S |j | ||||S )ad Build an rdata object from text format. This function attempts to dynamically load a class which implements the specified rdata class and type. If there is no class-and-type-specific implementation, the GenericRdata class is used. Once a class is chosen, its from_text() class method is called with the parameters to this function. If I{tok} is a string, then a tokenizer is created and the string is used as its input. @param rdclass: The rdata class @type rdclass: int @param rdtype: The rdata type @type rdtype: int @param tok: The tokenizer or input text @type tok: dns.tokenizer.Tokenizer or string @param origin: The origin to use for relative names @type origin: dns.name.Name @param relativize: Should names be relativized? @type relativize: bool @rtype: dns.rdata.Rdata instancez\#r )r r r+ Z tokenizer Tokenizerr| ra re Zungetrf rg r= rY r r )r' r( rU r2 r3 rT rj r< r r r r= s r= c C s* t jj|}t| |}|j| |||||S )a> Build an rdata object from wire format This function attempts to dynamically load a class which implements the specified rdata class and type. If there is no class-and-type-specific implementation, the GenericRdata class is used. Once a class is chosen, its from_wire() class method is called with the parameters to this function. @param rdclass: The rdata class @type rdclass: int @param rdtype: The rdata type @type rdtype: int @param wire: The wire-format message @type wire: string @param current: The offset in wire of the beginning of the rdata. @type current: int @param rdlen: The length of the wire-format rdata @type rdlen: int @param origin: The origin to use for relative names @type origin: dns.name.Name @rtype: dns.rdata.Rdata instance)r+ ZwiredataZ maybe_wrapr| rY )r' r( rV rW rX r2 rT r r r rY s rY )NT)N) r^ ior r r Z dns.exceptionr+ Zdns.nameZdns.rdataclassZ dns.rdatatypeZ dns.tokenizerZ dns.wiredataZ_compatr r r Z_hex_chunksizer Z_base64_chunksizer r r r# r% objectr& ra rx rz r| r= rY r r r r <module> s2 8," /PK g\` 7 7 __pycache__/edns.cpython-36.pycnu [ 3 bW @ s@ d Z dZG dd deZG dd deZi Zdd Zdd Zd S ) z EDNS Options c @ sd e Zd ZdZdd Zdd Zedd Zdd Zd d Z d d Z dd Z dd Z dd Z dd ZdS )Optionz*Base class for all EDNS option types. c C s || _ dS )z\Initialize an option. @param otype: The rdata type @type otype: int N)otype)selfr r /usr/lib/python3.6/edns.py__init__ s zOption.__init__c C s t dS )z*Convert an option to wire format. N)NotImplementedError)r filer r r to_wire! s zOption.to_wirec C s t dS )a Build an EDNS option object from wire format @param otype: The option type @type otype: int @param wire: The wire-format message @type wire: string @param current: The offset in wire of the beginning of the rdata. @type current: int @param olen: The length of the wire-format option data @type olen: int @rtype: dns.edns.Option instanceN)r )clsr wirecurrentolenr r r from_wire& s zOption.from_wirec C s t dS )zCompare an EDNS option with another option of the same type. Return < 0 if self < other, 0 if self == other, and > 0 if self > other. N)r )r otherr r r _cmp5 s z Option._cmpc C s, t |tsdS | j|jkr dS | j|dkS )NF ) isinstancer r r )r r r r r __eq__< s z Option.__eq__c C s, t |tsdS | j|jkr dS | j|dkS )NFr )r r r r )r r r r r __ne__C s z Option.__ne__c C s* t |t s| j|jkr tS | j|dk S )Nr )r r r NotImplementedr )r r r r r __lt__J s z Option.__lt__c C s* t |t s| j|jkr tS | j|dkS )Nr )r r r r r )r r r r r __le__P s z Option.__le__c C s* t |t s| j|jkr tS | j|dkS )Nr )r r r r r )r r r r r __ge__V s z Option.__ge__c C s* t |t s| j|jkr tS | j|dkS )Nr )r r r r r )r r r r r __gt__\ s z Option.__gt__N)__name__ __module__ __qualname____doc__r r classmethodr r r r r r r r r r r r r s r c s< e Zd ZdZ fddZdd Zedd Zdd Z Z S ) GenericOptionzwGenerate Rdata Class This class is used for EDNS option types for which we have no better implementation. c s t t| j| || _d S )N)superr r data)r r r" ) __class__r r r k s zGenericOption.__init__c C s |j | j d S )N)writer" )r r r r r r o s zGenericOption.to_wirec C s | ||||| S )Nr )r r r r r r r r r r s zGenericOption.from_wirec C s$ | j |j krdS | j |j kr dS dS )Nr )r" )r r r r r r v s zGenericOption._cmp) r r r r r r r r r __classcell__r r )r# r r c s r c C s t j| }|d krt}|S )N)_type_to_classgetr )r r r r r get_option_class s r* c C s t | }|j| |||S )au Build an EDNS option object from wire format @param otype: The option type @type otype: int @param wire: The wire-format message @type wire: string @param current: The offset in wire of the beginning of the rdata. @type current: int @param olen: The length of the wire-format option data @type olen: int @rtype: dns.edns.Option instance)r* r )r r r r r r r r option_from_wire s r+ N)r ZNSIDobjectr r r( r* r+ r r r r <module> s NPK g\k' ' # __pycache__/namedict.cpython-36.pycnu [ 3 bW] @ s6 d Z ddlZddlZddlmZ G dd dejZdS )zDNS name dictionary N )xrangec @ sb e Zd ZdZdddgZdd Zdd Zd d Zd d Zd d Z dd Z dd Z dd Z dd Z dS )NameDicta A dictionary whose keys are dns.name.Name objects. @ivar max_depth: the maximum depth of the keys that have ever been added to the dictionary. @type max_depth: int @ivar max_depth_items: the number of items of maximum depth @type max_depth_items: int max_depthmax_depth_itemsZ__storec O s( t | _d| _d| _| jt || d S )Nr )dict_NameDict__storer r update)selfargskwargs r /usr/lib/python3.6/namedict.py__init__- s zNameDict.__init__c C s> t || jkr | jd | _n t || jkr:t || _d| _d S )Nr )lenr r )r keyr r r Z__update_max_depth3 s zNameDict.__update_max_depthc C s | j | S )N)r )r r r r r __getitem__: s zNameDict.__getitem__c C s. t |tjjstd|| j|< | j| d S )NzNameDict key must be a name) isinstancednsnameName ValueErrorr _NameDict__update_max_depth)r r valuer r r __setitem__= s zNameDict.__setitem__c C sT | j j|}t|| jkr&| jd | _| jdkrPd| _x| j D ]}| j| q>W d S )Nr r )r popr r r r )r r r kr r r __delitem__C s zNameDict.__delitem__c C s t | jS )N)iterr )r r r r __iter__L s zNameDict.__iter__c C s t | jS )N)r r )r r r r __len__O s zNameDict.__len__c C s || j kS )N)r )r r r r r has_keyR s zNameDict.has_keyc C sn t |}|| jkr| j}x<t| dD ],}tjj||d }|| kr&|| | fS q&W | tjj }tjj|fS )a Find the deepest match to I{name} in the dictionary. The deepest match is the longest name in the dictionary which is a superdomain of I{name}. @param name: the name @type name: dns.name.Name object @rtype: (key, value) tuple r N)r r r r r r empty)r r depthinvr r r get_deepest_matchU s zNameDict.get_deepest_matchN)__name__ __module__ __qualname____doc__ __slots__r r r r r r r r! r' r r r r r ! s r )r+ collectionsZdns.namer Z_compatr MutableMappingr r r r r <module> s PK g\o o # __pycache__/wiredata.cpython-36.pycnu [ 3 bW @ s^ d Z ddlZddlZddlmZmZ G dd deZe dd ZG dd deZ d d Z dS ) zDNS Wire Data Helper N ) binary_type string_typesc @ s& e Zd Zdd Zejdk r"dd ZdS )_SliceUnspecifiedBoundc C s |j S )N)stop)selfkey r /usr/lib/python3.6/wiredata.py __getitem__ s z"_SliceUnspecifiedBound.__getitem__ c C s | j t||S )N)r slice)r ijr r r __getslice__$ s z#_SliceUnspecifiedBound.__getslice__N)r )__name__ __module__ __qualname__r sys version_infor r r r r r s r c s> e Zd Z fddZejd k r&dd Zdd Zdd Z Z S ) WireDatac s yt |tr|j}|j}tjdk rx|tkr2t| }|dk sB|dk rJtj j ||krt t | j | t t | j |d n6x4||fD ](}|d krqqt|t| krtj j qW t t t | j t||S t| j | S tk r tj j Y nX d S )Nr r r )r ) isinstancer startr r r _unspecified_boundlendns exception FormErrorsuperr r abs bytearrayunwrap IndexError)r r r r index) __class__r r r - s, zWireData.__getitem__r c C s | j t||S )N)r r )r r r r r r r P s zWireData.__getslice__c c sB d}x8y| | V |d7 }W q t jjk r8 tY qX qW d S )Nr r )r r r StopIteration)r r r r r __iter__S s zWireData.__iter__c C s t | S )N)r )r r r r r! \ s zWireData.unwrap)r ) r r r r r r r r& r! __classcell__r r )r$ r r * s " r c C sJ t | tr| S t | tr t| S t | tr6t| j S tdt| d S )Nzunhandled type %s)r r r r encode ValueErrortype)Zwirer r r maybe_wrap` s r+ ) __doc__r Z dns.exceptionr Z_compatr r r r r r+ r r r r <module> s 6PK g\0 % __pycache__/node.cpython-36.opt-1.pycnu [ 3 bW @ s< d Z ddlmZ ddlZddlZddlZG dd deZdS )z)DNS nodes. A node is a set of rdatasets. )StringIONc @ s e Zd ZdZdgZdd Zdd Zdd Zd d Zd d Z d d Z dd Z e j jdfddZe j jdfddZe j jfddZdd ZdS )NodezA DNS node. A node is a set of rdatasets @ivar rdatasets: the node's rdatasets @type rdatasets: list of dns.rdataset.Rdataset objects rdatasetsc C s g | _ dS )z Initialize a DNS node. N)r )self r /usr/lib/python3.6/node.py__init__$ s z Node.__init__c K sP t }x8| jD ].}t|dkr|j|j|f| |jd qW |j dd S )a+ Convert a node to text format. Each rdataset at the node is printed. Any keyword arguments to this method are passed on to the rdataset's to_text() method. @param name: the owner name of the rdatasets @type name: dns.name.Name object @rtype: string r N )r r lenwriteto_textgetvalue)r namekwsrdsr r r r * s z Node.to_textc C s dt t| d S )Nz <DNS node >)strid)r r r r __repr__; s z Node.__repr__c C s@ x | j D ]}||j krdS qW x |j D ]}|| j kr&dS q&W dS )zSTwo nodes are equal if they have the same rdatasets. @rtype: bool FT)r )r otherZrdr r r __eq__> s z Node.__eq__c C s | j | S )N)r )r r r r r __ne__N s z Node.__ne__c C s t | jS )N)r r )r r r r __len__Q s z Node.__len__c C s t | jS )N)iterr )r r r r __iter__T s z Node.__iter__Fc C sH x | j D ]}|j|||r|S qW |s*ttjj||}| j j| |S )a Find an rdataset matching the specified properties in the current node. @param rdclass: The class of the rdataset @type rdclass: int @param rdtype: The type of the rdataset @type rdtype: int @param covers: The covered type. Usually this value is dns.rdatatype.NONE, but if the rdtype is dns.rdatatype.SIG or dns.rdatatype.RRSIG, then the covers value will be the rdata type the SIG/RRSIG covers. The library treats the SIG and RRSIG types as if they were a family of types, e.g. RRSIG(A), RRSIG(NS), RRSIG(SOA). This makes RRSIGs much easier to work with than if RRSIGs covering different rdata types were aggregated into a single RRSIG rdataset. @type covers: int @param create: If True, create the rdataset if it is not found. @type create: bool @raises KeyError: An rdataset of the desired type and class does not exist and I{create} is not True. @rtype: dns.rdataset.Rdataset object )r matchKeyErrordnsrdatasetRdatasetappend)r rdclassrdtypecoverscreater r r r find_rdatasetW s zNode.find_rdatasetc C s2 y| j ||||}W n tk r, d}Y nX |S )aE Get an rdataset matching the specified properties in the current node. None is returned if an rdataset of the specified type and class does not exist and I{create} is not True. @param rdclass: The class of the rdataset @type rdclass: int @param rdtype: The type of the rdataset @type rdtype: int @param covers: The covered type. @type covers: int @param create: If True, create the rdataset if it is not found. @type create: bool @rtype: dns.rdataset.Rdataset object or None N)r( r )r r$ r% r& r' r r r r get_rdatasety s zNode.get_rdatasetc C s& | j |||}|dk r"| jj| dS )az Delete the rdataset matching the specified properties in the current node. If a matching rdataset does not exist, it is not an error. @param rdclass: The class of the rdataset @type rdclass: int @param rdtype: The type of the rdataset @type rdtype: int @param covers: The covered type. @type covers: int N)r) r remove)r r$ r% r& r r r r delete_rdataset s zNode.delete_rdatasetc C s: t |tjjstd| j|j|j|j | j j | dS )a8 Replace an rdataset. It is not an error if there is no rdataset matching I{replacement}. Ownership of the I{replacement} object is transferred to the node; in other words, this method does not store a copy of I{replacement} at the node, it stores I{replacement} itself. z replacement is not an rdatasetN) isinstancer r! r" ValueErrorr+ r$ r% r& r r# )r Z replacementr r r replace_rdataset s zNode.replace_rdatasetN)__name__ __module__ __qualname____doc__ __slots__r r r r r r r r Z rdatatypeZNONEr( r) r+ r. r r r r r s ! r ) r2 ior Z dns.rdatasetr Z dns.rdatatypeZ dns.rendererobjectr r r r r <module> s PK g\M # __pycache__/resolver.cpython-36.pycnu [ 3 >DW @ s d Z ddlZddlZddlZddlZy ddlZW n ek rL ddlZY nX ddl Z ddl Z ddl Z ddl Z ddlZ ddlZ ddlZ ddlZ ddlZ ddlZ ddlZ ddlZ ddlmZmZ ejdkry ddlZW n ek r ddlZY nX G dd de j j Z G dd d e j j Z e j j Z G d d d e j j Z!G d d d e j j Z"G dd de j j Z#G dd de j j Z$G dd de j j Z%G dd de&Z'G dd de&Z(G dd de&Z)G dd de&Z*G d d d e&Z+da,d d Z-d d! Z.e j/j0e j1j2d"dd#dfd$d%Z3e j1j2d"dfd&d'Z4ej5ej6gej7ej8giZ9da:ej;Z<ej=Z>ej?Z@ejAZBejCZDejEZFddejGdddfd(d)ZHd8d*d+ZId9d,d-ZJd.d/ ZKd0d1 ZLd2d3 ZMd:d4d5ZNd6d7 ZOdS );z{DNS stub resolver. @var default_resolver: The default resolver object @type default_resolver: dns.resolver.Resolver object N )xrange string_typeswin32c sV e Zd ZdZeddgZdZdddZ fddZd d Z e e d d Z d d Z Z S )NXDOMAINz"The DNS query name does not exist.qnames responsesNc C s\ t |tttfstdt|dkr,td|d kr:i }nt |tsLtdt||d}|S )Nz#qnames must be a list, tuple or setr z(qnames must contain at least one elementz(responses must be a dict(qname=response))r r ) isinstancelisttuplesetAttributeErrorlendict)selfr r kwargs r /usr/lib/python3.6/resolver.py _check_kwargs9 s zNXDOMAIN._check_kwargsc s^ d| j krtt| j S | j d }t|dkr4d}n| jd d }djtt|}d||f S )Nr r z None of DNS query names existz, z%s: %s) r superr __str__r __doc__joinmapstr)r r msg) __class__r r r E s zNXDOMAIN.__str__c C s d| j krtdtjj}tjj}d }xj| j d D ]\}| j d | }x4|jD ]*}|j|ksL|j |krfqL|j d j j }qLW |d k r2tj j|S q2W | j d d S )Nr z parametrized exception requiredr r )r TypeErrordns rdataclassIN rdatatypeCNAMEanswerrdtyperdclassitemstargetto_textname from_text)r r! r# cnameqnameresponser$ r r r canonical_nameP s zNXDOMAIN.canonical_namez%Return the unresolved canonical name.)docc C s| t | jjdg }t| jjdi }|jjdi }x<|jjdg D ]*}||krX|j| ||krB|| ||< qBW t||dS )z3Augment by results from another NXDOMAIN exception.r r )r r )r r getr appendr )r Ze_nxZqnames0Z responses0Z responses1Zqname1r r r __add__b s zNXDOMAIN.__add__)N) __name__ __module__ __qualname__r r supp_kwargsfmtr r r/ propertyr3 __classcell__r r )r r r 3 s r c @ s e Zd ZdZdS )YXDOMAINz8The DNS query name is too long after DNAME substitution.N)r4 r5 r6 r r r r r r; o s r; c s. e Zd ZdZdZedgZ fddZ ZS )NoAnswerz<The DNS response does not contain an answer to the question.z,The DNS response does not contain an answer zto the question: {query}r. c s t t| j|d jdS )Nr. )query)r r< _fmt_kwargsquestion)r r )r r r r> s zNoAnswer._fmt_kwargszDThe DNS response does not contain an answer to the question: {query}) r4 r5 r6 r r8 r r7 r> r: r r )r r r< z s r< c s@ e Zd ZdZdZdedd ZeddgZ fdd Z Z S ) NoNameserverszAll nameservers failed to answer the query. errors: list of servers and respective errors The type of errors is [(server ip address, any object convertible to string)]. Non-empty errors list will add explanatory message () z+All nameservers failed to answer the query.z%s {query}: {errors}Nr requesterrorsc sd g }x>|d D ]2}|j d|d |d r*dnd|d |d f qW tt| j|d jd j|d S ) NrB z Server %s %s port %s answered %sr r ZTCPZUDP rA z; )r= rB )r2 r r@ r> r? r )r r Zsrv_msgserr)r r r r> s & zNoNameservers._fmt_kwargsr ) r4 r5 r6 r r r8 r r7 r> r: r r )r r r@ s r@ c @ s e Zd ZdZdS ) NotAbsolutezEAn absolute domain name is required but a relative name was provided.N)r4 r5 r6 r r r r r rF s rF c @ s e Zd ZdZdS ) NoRootSOAzBThere is no SOA RR at the DNS root name. This should never happen!N)r4 r5 r6 r r r r r rG s rG c @ s e Zd ZdZdS ) NoMetaqueriesz DNS metaqueries are not allowed.N)r4 r5 r6 r r r r r rH s rH c @ sB e Zd ZdZdddZdd Zdd Zd d Zd d Zd d Z dS )Answera9 DNS stub resolver answer Instances of this class bundle up the result of a successful DNS resolution. For convenience, the answer object implements much of the sequence protocol, forwarding to its rrset. E.g. "for a in answer" is equivalent to "for a in answer.rrset", "answer[i]" is equivalent to "answer.rrset[i]", and "answer[i:j]" is equivalent to "answer.rrset[i:j]". Note that CNAMEs or DNAMEs in the response may mean that answer node's name might not be the query name. @ivar qname: The query name @type qname: dns.name.Name object @ivar rdtype: The query type @type rdtype: int @ivar rdclass: The query class @type rdclass: int @ivar response: The response message @type response: dns.message.Message object @ivar rrset: The answer @type rrset: dns.rrset.RRset object @ivar expiration: The time when the answer expires @type expiration: float (seconds since the epoch) @ivar canonical_name: The canonical name of the query name @type canonical_name: dns.name.Name object Tc C s || _ || _|| _|| _d}d }xtddD ]}y0|j|j|||}|dksV|j|k r\|j}P W q, tk r |t j j kryJ|j|j||t j j } |dks| j|k r| j}x| D ] } | j }P qW w,W n" tk r |rt |dY nX | rt |dY q,X q,W |d kr |r t |d|| _|| _|d krxyR|j|j||t j j} |dksf| j|k rl| j}| d j|k r| d j}P W n@ tk r y |j }W n t jjk r P Y nX Y nX q8W tj | | _d S ) Nr r )r. r r r r )r- r% r& r. r Z find_rrsetr$ ttlKeyErrorr r" r# r( r< r/ rrsetZ authoritySOAZminimumparentr* NoParenttime expiration) r r- r% r& r. raise_on_no_answerZmin_ttlrM countZcrrsetZrdZsrrsetr r r __init__ sf zAnswer.__init__c C s\ |dkr| j jS |dkr | j jS |dkr0| j jS |dkr@| j jS |dkrP| j jS t|d S )Nr* rK coversr& r% )rM r* rK rV r& r% r )r attrr r r __getattr__ s zAnswer.__getattr__c C s | j rt| j pdS )Nr )rM r )r r r r __len__ s zAnswer.__len__c C s | j rt| j ptt S )N)rM iterr )r r r r __iter__ s zAnswer.__iter__c C s | j | S )N)rM )r ir r r __getitem__ s zAnswer.__getitem__c C s | j |= d S )N)rM )r r\ r r r __delitem__ s zAnswer.__delitem__N)T) r4 r5 r6 r rU rX rY r[ r] r^ r r r r rI s 7rI c @ s< e Zd ZdZdddZdd Zdd Zd d Zdd d Zd S )Cacheaq Simple DNS answer cache. @ivar data: A dictionary of cached data @type data: dict @ivar cleaning_interval: The number of seconds between cleanings. The default is 300 (5 minutes). @type cleaning_interval: float @ivar next_cleaning: The time the cache should next be cleaned (in seconds since the epoch.) @type next_cleaning: float r@c C s* i | _ || _tj | j | _tj | _dS )zInitialize a DNS cache. @param cleaning_interval: the number of seconds between periodic cleanings. The default is 300.0 @type cleaning_interval: float. N)datacleaning_intervalrQ next_cleaning _threadingLocklock)r rb r r r rU - s zCache.__init__c C sp t j }| j|krlg }x*| jj D ] \}}|j|kr"|j| q"W x|D ] }| j|= qHW t j }|| j | _dS )z&Clean the cache if it's time to do so.N)rQ rc ra r' rR r2 rb )r nowZkeys_to_deletekvr r r _maybe_clean: s zCache._maybe_cleanc C sN z<| j j | j | jj|}|dks6|jtj kr:dS |S | j j X dS )a) Get the answer associated with I{key}. Returns None if no answer is cached for the key. @param key: the key @type key: (dns.name.Name, int, int) tuple whose values are the query name, rdtype, and rdclass. @rtype: dns.resolver.Answer object or None N)rf acquirerj ra r1 rR rQ release)r keyri r r r r1 H s z Cache.getc C s2 z | j j | j || j|< W d| j j X dS )a Associate key and value in the cache. @param key: the key @type key: (dns.name.Name, int, int) tuple whose values are the query name, rdtype, and rdclass. @param value: The answer being cached @type value: dns.resolver.Answer object N)rf rk rj ra rl )r rm valuer r r put[ s z Cache.putNc C sR z@| j j |dk r(|| jkr>| j|= ni | _tj | j | _W d| j j X dS )zFlush the cache. If I{key} is specified, only that item is flushed. Otherwise the entire cache is flushed. @param key: the key to flush @type key: (dns.name.Name, int, int) tuple or None N)rf rk ra rQ rb rc rl )r rm r r r flushk s z Cache.flush)r` )N) r4 r5 r6 r rU rj r1 ro rp r r r r r_ s r_ c @ s0 e Zd ZdZdd Zdd Zdd Zdd Zd S ) LRUCacheNodezLRUCache node. c C s || _ || _| | _| | _d S )N)rm rn prevnext)r rm rn r r r rU s zLRUCacheNode.__init__c C s |j | _ || _| |j _| |_ d S )N)rr rs )r noder r r link_before s zLRUCacheNode.link_beforec C s || _ |j| _| |j_ | |_d S )N)rr rs )r rt r r r link_after s zLRUCacheNode.link_afterc C s | j | j_ | j| j _d S )N)rr rs )r r r r unlink s zLRUCacheNode.unlinkN)r4 r5 r6 r rU ru rv rw r r r r rq s rq c @ s< e Zd ZdZdddZdd Zdd Zd d Zdd d Zd S )LRUCacheaO Bounded least-recently-used DNS answer cache. This cache is better than the simple cache (above) if you're running a web crawler or other process that does a lot of resolutions. The LRUCache has a maximum number of nodes, and when it is full, the least-recently used node is removed to make space for a new one. @ivar data: A dictionary of cached data @type data: dict @ivar sentinel: sentinel node for circular doubly linked list of nodes @type sentinel: LRUCacheNode object @ivar max_size: The maximum number of nodes @type max_size: int 順 c C s* i | _ | j| tdd| _tj | _dS )zInitialize a DNS cache. @param max_size: The maximum number of nodes to cache; the default is 100,000. Must be greater than 1. @type max_size: int N)ra set_max_sizerq sentinelrd re rf )r max_sizer r r rU s zLRUCache.__init__c C s |dk r d}|| _ d S )Nr )r| )r r| r r r rz s zLRUCache.set_max_sizec C sl zZ| j j | jj|}|dkr$dS |j |jjtj krJ| j|j= dS |j | j |jS | j j X dS )a) Get the answer associated with I{key}. Returns None if no answer is cached for the key. @param key: the key @type key: (dns.name.Name, int, int) tuple whose values are the query name, rdtype, and rdclass. @rtype: dns.resolver.Answer object or None N) rf rk ra r1 rw rn rR rQ rm rv r{ rl )r rm rt r r r r1 s z LRUCache.getc C s z| j j | jj|}|dk r2|j | j|j= x.t| j| jkr`| jj }|j | j|j= q4W t ||}|j | j || j|< W d| j j X dS )a Associate key and value in the cache. @param key: the key @type key: (dns.name.Name, int, int) tuple whose values are the query name, rdtype, and rdclass. @param value: The answer being cached @type value: dns.resolver.Answer object N) rf rk ra r1 rw rm r r| r{ rr rq rv rl )r rm rn rt r r r ro s z LRUCache.putNc C s zr| j j |dk r<| jj|}|dk rp|j | j|j= n4| jj}x$|| jkrh|j}d|_d|_|}qFW i | _W d| j j X dS )zFlush the cache. If I{key} is specified, only that item is flushed. Otherwise the entire cache is flushed. @param key: the key to flush @type key: (dns.name.Name, int, int) tuple or None N) rf rk ra r1 rw rm r{ rs rr rl )r rm rt rs r r r rp s zLRUCache.flush)ry )N) r4 r5 r6 r rU rz r1 ro rp r r r r rx s rx c @ s e Zd ZdZd%ddZdd Zdd Zd d Zd d Zdd Z dd Z dd Z dd Z dd Z dd Zejjejjdddd fd d Zdejjfd d Zd!d" Zd#d$ ZdS )&Resolvera- DNS stub resolver @ivar domain: The domain of this host @type domain: dns.name.Name object @ivar nameservers: A list of nameservers to query. Each nameserver is a string which contains the IP address of a nameserver. @type nameservers: list of strings @ivar search: The search list. If the query name is a relative name, the resolver will construct an absolute query name by appending the search names one by one to the query name. @type search: list of dns.name.Name objects @ivar port: The port to which to send queries. The default is 53. @type port: int @ivar timeout: The number of seconds to wait for a response from a server, before timing out. @type timeout: float @ivar lifetime: The total number of seconds to spend trying to get an answer to the question. If the lifetime expires, a Timeout exception will occur. @type lifetime: float @ivar keyring: The TSIG keyring to use. The default is None. @type keyring: dict @ivar keyname: The TSIG keyname to use. The default is None. @type keyname: dns.name.Name object @ivar keyalgorithm: The TSIG key algorithm to use. The default is dns.tsig.default_algorithm. @type keyalgorithm: string @ivar edns: The EDNS level to use. The default is -1, no Edns. @type edns: int @ivar ednsflags: The EDNS flags @type ednsflags: int @ivar payload: The EDNS payload size. The default is 0. @type payload: int @ivar flags: The message flags to use. The default is None (i.e. not overwritten) @type flags: int @ivar cache: The cache to use. The default is None. @type cache: dns.resolver.Cache object @ivar retry_servfail: should we retry a nameserver if it says SERVFAIL? The default is 'false'. @type retry_servfail: bool /etc/resolv.confTc C s d| _ d| _d| _d| _d| _d| _d| _d| _d| _d| _ d| _ d| _ d| _ d| _ d| _d| _d| _| j |rtjdkr| j n|r| j| dS )aJ Initialize a resolver instance. @param filename: The filename of a configuration file in standard /etc/resolv.conf format. This parameter is meaningful only when I{configure} is true and the platform is POSIX. @type filename: string or file object @param configure: If True (the default), the resolver instance is configured in the normal fashion for the operating system the resolver is running on. (I.e. a /etc/resolv.conf file on POSIX systems and from the registry on Windows systems.) @type configure: boolNFr )domain nameserversnameserver_portsportsearchtimeoutlifetimekeyringkeyname keyalgorithmedns ednsflagspayloadcacheflagsretry_servfailrotateresetsysplatform read_registryread_resolv_conf)r filenameZ configurer r r rU 9 s. zResolver.__init__c C s t jjt jjtj dd | _t| jdkr:t jj| _g | _ i | _ d| _ g | _ d| _ d| _d| _d| _t jj| _d| _d| _d| _d| _d| _d| _d| _dS ) z1Reset all resolver configuration to the defaults.r Nr 5 g @g >@Fr )r r* Namer+ socket gethostnamer r rootr r r r r r r r tsigdefault_algorithmr r r r r r r r )r r r r r _ s& " zResolver.resetc C sZ t |tr<yt|d}W n tk r4 dg| _dS X d}nd}zx|D ]}t|dksH|d dksH|d dkrrqH|j }t|d k rqH|d d kr| jj|d qH|d d krtj j |d | _ qH|d d kr xL|d d D ]}| j jtj j | qW qH|d dkrHd|d d krHd| _ qHW W d|r8|j X t| jdkrV| jjd dS )zProcess f as a file in the /etc/resolv.conf format. If f is a string, it is used as the name of the file to open; otherwise it is treated as the file itself.rz 127.0.0.1NTFr #;rC nameserverr r r Zoptionsr )r r openIOErrorr r splitr2 r r* r+ r r r close)r fZ want_closeltokenssuffixr r r r v s: $ zResolver.read_resolv_confc C s0 |j ddkrd}n|j ddkr(d}nd}|S )N r ,)find)r entry split_charr r r _determine_split_char s z Resolver._determine_split_charc C sD t |}| j|}|j|}x"|D ]}|| jkr"| jj| q"W dS )z&Configure a NameServer registry entry.N)r r r r r2 )r r r Zns_listnsr r r _config_win32_nameservers s z"Resolver._config_win32_nameserversc C s t jjt|| _dS )z"Configure a Domain registry entry.N)r r* r+ r r )r r r r r _config_win32_domain s z Resolver._config_win32_domainc C sL t |}| j|}|j|}x*|D ]"}|| jkr"| jjtjj| q"W dS )z"Configure a Search registry entry.N)r r r r r2 r r* r+ )r r r Z search_listsr r r _config_win32_search s z Resolver._config_win32_searchc # C s. yt j|d\}}W n tk r, d}Y nX |rv| j| y"t j|d\}}|r\| j| W q tk rr Y qX ntyt j|d\}}W n tk r d}Y nX |r| j| y"t j|d\}}|r| j| W n tk r Y nX yt j|d\}}W n tk r d}Y nX |r*| j| dS )z%Extract DNS info from a registry key.Z NameServerNZDomainZDhcpNameServerZ DhcpDomainZ SearchList)_winreg QueryValueEx WindowsErrorr r r )r rm ZserversZrtypeZdomr r r r _config_win32_fromkey s< z Resolver._config_win32_fromkeyc , C s t jdt j}d}zyt j|d}d}W n tk rH t j|d}Y nX z| j| W d|j X |rt j|d}ztd}xjyNt j||}|d7 }t j||}| j|||sw|z| j| W d|j X W q| tk r P Y q|X q|W W d|j X W d|j X dS ) z9Extract resolver configuration from the Windows registry.NFz2SYSTEM\CurrentControlSet\Services\Tcpip\ParametersTz+SYSTEM\CurrentControlSet\Services\VxD\MSTCPz=SYSTEM\CurrentControlSet\Services\Tcpip\Parameters\Interfacesr r ) r ZConnectRegistryHKEY_LOCAL_MACHINEOpenKeyEnvironmentErrorr CloseZEnumKey_win32_is_nic_enabled)r lmZ want_scanZ tcp_paramsZ interfacesr\ guidrm r r r r s@ zResolver.read_registryc C s yt j|d| }zft j|d\}}|t jkr2tt j|d| }z(t j|d\}}|t jkrbt|d@ S |j X W d |j X W nF ttfk r yt j|d\} }| d k S tk r dS X Y nX d S )Nz]SYSTEM\CurrentControlSet\Control\Network\{4D36E972-E325-11CE-BFC1-08002BE10318}\%s\ConnectionZ PnpInstanceIDz SYSTEM\CurrentControlSet\Enum\%sZ ConfigFlagsr ZNTEContextListF) r r r ZREG_SZ ValueErrorZ REG_DWORDr r r ) r r r Z interface_keyZconnection_keyZpnp_idZttypeZ device_keyr Znter r r r s6 z Resolver._win32_is_nic_enabledc C sV t j }|| }|dk r0|dk r,t|dn|}|| jkrDt|dt| j| | jS )Nr r )r r )rQ Timeoutr minr )r startrg Zdurationr r r _compute_timeoutM s zResolver._compute_timeoutFNr c C s t |trtjj|d}t |tr.tjj|}tjj|r>tt |trTtjj|}tjj |rdtg }|j r||j | nZt |dkr|j |j tjj | jrx2| jD ]} |j |j | qW n|j |j | j d} i } tj } d} x|D ]} | jr@| jj| ||f}|dk r@|jdkr<|r<t|jdn|S tjj| ||}| jdk rr|j| j| j| j d |j | j | j | j | j!dk r| j!|_!d}| j"dd }g }| j#rt$j%| d}x|dkrt |dkrt&||dx`|dd D ]N}| j'| }| j(j|| j)}yx|}|rDtj*j+||||||d }nNtj*j,||||||d }|j!tj!j-@ rd}| j'| }tj*j+||||||d }W n t.j/tj0j1fk r } z"|j |||||f d}wW Y dd}~X n tj*j2k r" } z"|j |||||f d}wW Y dd}~X n tj0j3k rn } z,|j4| |j |||||f d}wW Y dd}~X nJ t5k r } z,|j4| |j |||||f d}wW Y dd}~X nX |j6 }|tj6j7krt7 }|j |||||f ||tj6j8ks|tj6j9kr P |tj6j:ks"| j; r,|j4| |j |||tj6j<||f d}qW |dk r^P t |dkr| j'| }t=||}|d 9 }tj>| qW |j6 tj6j9kr|| | < qd } P qW | rt9|| d t?| ||||}| jr| jj@| ||f| |S ) a Query nameservers to find the answer to the question. The I{qname}, I{rdtype}, and I{rdclass} parameters may be objects of the appropriate type, or strings that can be converted into objects of the appropriate type. E.g. For I{rdtype} the integer 2 and the the string 'NS' both mean to query for records with DNS rdata type NS. @param qname: the query name @type qname: dns.name.Name object or string @param rdtype: the query type @type rdtype: int or string @param rdclass: the query class @type rdclass: int or string @param tcp: use TCP to make the query (default is False). @type tcp: bool @param source: bind to this IP address (defaults to machine default IP). @type source: IP address in dotted quad notation @param raise_on_no_answer: raise NoAnswer if there's no answer (defaults is True). @type raise_on_no_answer: bool @param source_port: The port from which to send the message. The default is 0. @type source_port: int @rtype: dns.resolver.Answer instance @raises Timeout: no answers could be found in the specified lifetime @raises NXDOMAIN: the query name does not exist @raises YXDOMAIN: the query name is too long after DNAME substitution @raises NoAnswer: the response did not contain an answer and raise_on_no_answer is True. @raises NoNameservers: no non-broken nameservers are available to answer the question.Nr T)r. ) algorithmg?r )rA rB )source source_portrC F)r r )Ar r r r* r+ r" Z is_metatyperH r Z is_metaclass is_absoluter2 r Z concatenater r r rQ r r1 rM r< r. messageZ make_queryr use_tsigr r use_ednsr r r r r r randomZshuffler@ r r r r= tcpudpZTCr error exceptionr ZUnexpectedSourceZ FormErrorremoveEOFErrorrcoder; ZNOERRORr ZSERVFAILr r) r ZsleeprI ro )r r- r% r& r r rS r Z qnames_to_tryr Z all_nxdomainZnxdomain_responsesr Z_qnamer$ rA r. r rB Zbackoffr r r Z tcp_attemptZexr Z sleep_timer r r r= ] s # zResolver.queryc C s4 || _ |dkr$t| j j d | _n|| _|| _dS )a Add a TSIG signature to the query. @param keyring: The TSIG keyring to use; defaults to None. @type keyring: dict @param keyname: The name of the TSIG key to use; defaults to None. The key must be defined in the keyring. If a keyring is specified but a keyname is not, then the key used will be the first key in the keyring. Note that the order of keys in a dictionary is not defined, so applications should supply a keyname when a keyring is used, unless they know the keyring contains only one key. @param algorithm: The TSIG key algorithm to use. The default is dns.tsig.default_algorithm. @type algorithm: stringNr )r r keysr r )r r r r r r r r " s zResolver.use_tsigc C s" |dkr d}|| _ || _|| _dS )a Configure Edns. @param edns: The EDNS level to use. The default is -1, no Edns. @type edns: int @param ednsflags: The EDNS flags @type ednsflags: int @param payload: The EDNS payload size. The default is 0. @type payload: intNr r )r r r )r r r r r r r r 8 s zResolver.use_ednsc C s || _ dS )zOverrides the default flags with your own @param flags: The flags to overwrite the default with @type flags: intN)r )r r r r r set_flagsH s zResolver.set_flags)r~ T)r4 r5 r6 r rU r r r r r r r r r r r r" Ar r! r= r r r r r r r r r r} s& + &) "-7 Er} c C s t dkrt t S )z7Get the default resolver, initializing it if necessary.N)default_resolverreset_default_resolverr r r r get_default_resolverR s r c C s t adS )zSRe-initialize default resolver. resolv.conf will be re-read immediatelly. N)r} r r r r r r Y s r FTc C s t j| ||||||S )zQuery nameservers to find the answer to the question. This is a convenience function that uses the default resolver object to make the query. @see: L{dns.resolver.Resolver.query} for more information on the parameters.)r r= )r- r% r& r r rS r r r r r= b s r= c C s t | tr tjj| tjj} |dkr*t }| j s:t| xxy(|j | tj j ||}|j j| krb| S W n tj jtj jfk r Y nX y | j } W q< tjjk r tY q<X q<W dS )a Find the name of the zone which contains the specified name. @param name: the query name @type name: absolute dns.name.Name object or string @param rdclass: The query class @type rdclass: int @param tcp: use TCP to make the query (default is False). @type tcp: bool @param resolver: the resolver to use @type resolver: dns.resolver.Resolver object or None @rtype: dns.name.NameN)r r r r* r+ r r r rF r= r" rN rM resolverr r< rO rP rG )r* r& r r r$ r r r zone_for_nameo s" r c , C s |t jt jB @ dkrt| d kr4|d kr4t jt jg }g }d }y| d krd}|t j@ dkrr|jd |jd q|jd |jd n>| jd} t | dkr| d } n| } t j j | } |j| | }W np t k r: y t jj | } |j| | }W n8 t k r4 |t j@ dkr0y|t jks8|t jkrtj| t jjd d } | j} | jjd }| jd k rx | jD ]} |j| j qrW |t jks|t jkrtj| t jj d d }|j} |jjd }|jd k rx |jD ]} |j| j qW W n< t j j k r t jt jY n t jt j Y nX Y nX Y nX d }y |d krRd}nt |}W nL t k r |t j!@ dkryt j"|}W n t k r Y nX Y nX |d krt jt jg }|dkrt j#t j$g}n|g}|t j%@ dkr|}nd }|t jks|t jkrfxP|D ]H} x@|D ]8}x0t&| D ]$}|jt j|||| |ddff q2W q$W qW |t jks~|t jkrxL|D ]D} x<|D ]4}x,t&| D ] }|jt j|||| |ff qW qW qW t |dkrt jt j|S ) Nr Z localhostz::z0.0.0.0z::1z 127.0.0.1%rC F)rS T )'r Z AI_ADDRCONFIGZ AI_V4MAPPEDNotImplementedErrorgaierror EAI_NONAMEZ AI_PASSIVEr2 r r r ipv6 inet_aton ExceptionZipv4ZAI_NUMERICHOSTAF_INET6 AF_UNSPEC _resolverr= r" ZAAAAr- r/ r) rM ZaddressAF_INETr r r Z EAI_SYSTEMintZAI_NUMERICSERVZ getservbyname SOCK_DGRAM SOCK_STREAM AI_CANONNAME_protocols_for_socktype)hostservicefamilyZsocktypeprotor Zv6addrsZv4addrsr/ partsZahostaddrZv6ZrdataZv4r tuplesZ socktypesr, r r r _getaddrinfo s $ r c C sf | d }| d }t | dkr,| d }tj}n d }tj}t|||tjtjd}t |dkrbtjd|d d d }|tj@ rd}nd}t j j |} |tj @ dkr y"t j| d} | jd jjd } W nV t jjt jjfk r |tj@ rtjtj|} |d k r| d t| 7 } Y nX n |} |d k r<| d t| 7 } |tj@ rRt|} n tj||} | | fS ) Nr r rD z'sockaddr resolved to multiple addressesr r ZPTRTr )r r r r r r SOL_TCPr ZNI_DGRAMr Z reversenameZ from_addressZNI_NUMERICHOSTr r= rM r( r) r r r< NI_NAMEREQDr r r ZNI_NUMERICSERVZ getservbyport) sockaddrr r r Zscoper r r Zpnamer- r$ Zhostnamer r r r _getnameinfo sB r c C sD | d krt j } ytt| dd d d S tk r> | S X d S )NP r r )r r r r r )r* r r r _getfqdn. s r c C s t | d d S )NrC r )_gethostbyname_ex)r* r r r _gethostbyname7 s r c C sX g }g }t | dtjtjtjtj}|d d }x |D ]}|j|d d q4W |||fS )Nr rD r )r r r r r r r2 )r* aliases addressesr canonicalitemr r r r ; s r c C s y"t jj| | dddf}tj}W n" tk rD | df}tj}Y nX t|tj\}}g }g }t |d|tj tj tj }|d d }x |D ]} |j | d d qW |||fS )Nr r rD r )r r r r r r r r r r r r r r2 ) Zipr r r* r r r r r r r r r _gethostbyaddrG s r c C s: | dkrt } | att_tt_tt_t t_ t t_ t t_dS )a Override the system resolver routines in the socket module with versions which use dnspython's resolver. This can be useful in testing situations where you want to control the resolution behavior of python code without having to change the system's resolver settings (e.g. /etc/resolv.conf). The resolver to use may be specified; if it's not, the default resolver will be used. @param resolver: the resolver to use @type resolver: dns.resolver.Resolver object or None N)r r r r getaddrinfor getnameinfor getfqdnr gethostbynamer gethostbyname_exr gethostbyaddr)r r r r override_system_resolver[ s r c C s, da tt_tt_tt_tt_ t t_ t t_ dS )z4Undo the effects of override_system_resolver(). N)r _original_getaddrinfor r _original_getnameinfor _original_getfqdnr _original_gethostbynamer _original_gethostbyname_exr _original_gethostbyaddrr r r r r restore_system_resolveru s r )r )N)N)Pr r r rQ r Z threadingrd ImportErrorZdummy_threadingZ dns.exceptionr Z dns.flagsZdns.ipv4Zdns.ipv6Z dns.messageZdns.nameZ dns.queryZ dns.rcodeZdns.rdataclassZ dns.rdatatypeZdns.reversenameZdns.tsigZ_compatr r r winregr r Z DNSExceptionr r; r r< r@ rF rG rH objectrI r_ rq rx r} r r r r" r r r! r= r r ZSOL_UDPr r r r r r r r r r r r r r r r r r r r r r r r r r r r r <module> s < sb o G & c ( PK g\֙O'% '% ) __pycache__/rdataset.cpython-36.opt-1.pycnu [ 3 bW$- @ s d Z ddlZddlmZ ddlZddlZddlZddlZddl Zddl Zddl m Z ej jZG dd dejjZG dd d ejjZG d d d ej jZd d Zdd Zdd Zdd ZdS )zHDNS rdatasets (an rdataset is a set of rdatas of a given type and class) N)StringIO ) string_typesc @ s e Zd ZdZdS )DifferingCoversz~An attempt was made to add a DNS SIG/RRSIG whose covered type is not the same as that of the other rdatas in the rdataset.N)__name__ __module__ __qualname____doc__ r r /usr/lib/python3.6/rdataset.pyr ! s r c @ s e Zd ZdZdS )IncompatibleTypesz?An attempt was made to add DNS RR data of an incompatible type.N)r r r r r r r r r ' s r c s e Zd ZdZddddgZejjf fdd Z fdd Z d d Z d$ fd d Z fddZ fddZ fddZdd Zdd Z fddZdd Zd%d d Zd&d d!Zd"d# Z ZS )'Rdataseta A DNS rdataset. @ivar rdclass: The class of the rdataset @type rdclass: int @ivar rdtype: The type of the rdataset @type rdtype: int @ivar covers: The covered type. Usually this value is dns.rdatatype.NONE, but if the rdtype is dns.rdatatype.SIG or dns.rdatatype.RRSIG, then the covers value will be the rdata type the SIG/RRSIG covers. The library treats the SIG and RRSIG types as if they were a family of types, e.g. RRSIG(A), RRSIG(NS), RRSIG(SOA). This makes RRSIGs much easier to work with than if RRSIGs covering different rdata types were aggregated into a single RRSIG rdataset. @type covers: int @ivar ttl: The DNS TTL (Time To Live) value @type ttl: int rdclassrdtypecoversttlc s* t t| j || _|| _|| _d| _dS )zCreate a new rdataset of the specified class and type. @see: the description of the class instance variables for the meaning of I{rdclass} and I{rdtype}r N)superr __init__r r r r )selfr r r ) __class__r r r C s zRdataset.__init__c s2 t t| j }| j|_| j|_| j|_| j|_|S )N)r r _cloner r r r )r obj)r r r r O s zRdataset._clonec C s( t | dkr|| _n|| jk r$|| _dS )zSet the TTL of the rdataset to be the lesser of the set's current TTL or the specified TTL. If the set contains no rdatas, set the TTL to the specified TTL. @param ttl: The TTL @type ttl: intr N)lenr )r r r r r update_ttlW s zRdataset.update_ttlNc s | j |j ks| j|jkr t|dk r.| j| | jtjjksJ| jtjjkr|j }t | dkrt| jtjj krt|| _n| j|krt tjj |jrt | dkr| j tt| j| dS )a% Add the specified rdata to the rdataset. If the optional I{ttl} parameter is supplied, then self.update_ttl(ttl) will be called prior to adding the rdata. @param rd: The rdata @type rd: dns.rdata.Rdata object @param ttl: The TTL @type ttl: intNr )r r r r dns rdatatypeZRRSIGZSIGr r NONEr Z is_singletonclearr r add)r rdr r )r r r r c s z Rdataset.addc s | j |j tt| j| d S )N)r r r r union_update)r other)r r r r s zRdataset.union_updatec s | j |j tt| j| d S )N)r r r r intersection_update)r r! )r r r r" s z Rdataset.intersection_updatec s | j |j tt| j| dS )zAdd all rdatas in other to self. @param other: The rdataset from which to update @type other: dns.rdataset.Rdataset objectN)r r r r update)r r! )r r r r# s zRdataset.updatec C sR | j dkrd}ndtjj| j d }dtjj| j d tjj| j | d S )Nr ()z<DNS z rdataset>)r r r to_text rdataclassr r )r Zctextr r r __repr__ s zRdataset.__repr__c C s | j S )N)r( )r r r r __str__ s zRdataset.__str__c sF t |tsdS | j|jks2| j|jks2| j|jkr6dS tt| j|S )zTwo rdatasets are equal if they have the same class, type, and covers, and contain the same rdata. @rtype: boolF) isinstancer r r r r __eq__)r r! )r r r r- s zRdataset.__eq__c C s | j | S )N)r- )r r! r r r __ne__ s zRdataset.__ne__Tc K s |dk r"|j ||}t|}d}nd}d}t }|dk r>|} n| j} t| dkrz|jd||tjj| tj j| j f nNxL| D ]D} |jd||| j tjj| tj j| j | jf ||d|f qW |j dd S ) a Convert the rdataset into DNS master file format. @see: L{dns.name.Name.choose_relativity} for more information on how I{origin} and I{relativize} determine the way names are emitted. Any additional keyword arguments are passed on to the rdata to_text() method. @param name: If name is not None, emit a RRs with I{name} as the owner name. @type name: dns.name.Name object @param origin: The origin for relative names, or None. @type origin: dns.name.Name object @param relativize: True if names should names be relativized @type relativize: boolNr' r$ r z %s%s%s %s z%s%s%d %s %s %s )origin relativizer ) Zchoose_relativitystrr r r writer r) r( r r r getvalue) r namer/ r0 override_rdclasskwZntextZpadsr r r r r r( s* zRdataset.to_textc C s |dk r|}d}n| j }|jdd t| dkr`|j||| tjd| j|dd}|j| dS |rxt| } t j | n| } x| D ]} |j||| tjd| j|| j d}|j| |j } | j||| |j } |j| d tjd| | }|j| |jdd qW t| S dS )a, Convert the rdataset to wire format. @param name: The owner name of the RRset that will be emitted @type name: dns.name.Name object @param file: The file to which the wire format data will be appended @type file: file @param compress: The compression table to use; the default is None. @type compress: dict @param origin: The origin to be appended to any relative names when they are emitted. The default is None. @returns: the number of records emitted @rtype: int NFr z!HHIHr z!H) r seekr to_wirestructpackr r3 listrandomZshuffler tell) r r5 filecompressr/ r6 Z want_shuffler Zstufflr startendr r r r; s6 zRdataset.to_wirec C s& | j |kr"| j|kr"| j|kr"dS dS )zSReturns True if this rdataset matches the specified class, type, and coversTF)r r r )r r r r r r r match s zRdataset.match)N)NNTN)NNNT)r r r r __slots__r r r r r r r r r" r# r* r+ r- r. r( r; rF __classcell__r r )r r r , s$ 2 /r c C sp t | trtjj| } t |tr,tjj|}t| |}|j| x*|D ]"}tjj|j |j |}|j | qFW |S )zCreate an rdataset with the specified class, type, and TTL, and with the specified list of rdatas in text format. @rtype: dns.rdataset.Rdataset object ) r, r r r) from_textr r r Zrdatar r r )r r r text_rdatasrtr r r r from_text_list s rM c G s t | |||S )zCreate an rdataset with the specified class, type, and TTL, and with the specified rdatas in text format. @rtype: dns.rdataset.Rdataset object )rM )r r r rJ r r r rI / s rI c C sT t |dkrtdd}x6|D ].}|dkrBt|j|j}|j| |j| q W |S )zCreate an rdataset with the specified TTL, and with the specified list of rdata objects. @rtype: dns.rdataset.Rdataset object r z rdata list must not be emptyN)r ValueErrorr r r r r )r rdatasrK r r r r from_rdata_list9 s rP c G s t | |S )zCreate an rdataset with the specified TTL, and with the specified rdata objects. @rtype: dns.rdataset.Rdataset object )rP )r rO r r r from_rdataK s rQ )r r? ior r< Z dns.exceptionr Z dns.rdatatypeZdns.rdataclassZ dns.rdataZdns.setZ_compatr setSetZ SimpleSetZ exceptionZ DNSExceptionr r r rM rI rP rQ r r r r <module> s$ q PK g\ȟ % __pycache__/ipv6.cpython-36.opt-1.pycnu [ 3 bW @ s d Z ddlZddlZddlZddlZddlmZmZm Z ej dZ dd Z ej dZ ej d Zej d Zd d ZdZdd ZdS )zIPv6 helper functions. N )xrange binary_type maybe_decodes 0+([0-9a-f]+)c C s t | dkrtdtj| }g }d}t |}xJ||k rx|||d }tj|}|dk rd|jd}|j| |d7 }q0W d}d}d} d} xNtdD ]B}|| d kr| r|} | | } | |kr| }| }d} q| s|} d } qW | rd} | | } | |k r| }| }|dkr|dkrb|d ks4|d krb|d d krb|d krDd} nd} | t j j | dd }n,dj |d| d dj ||| d }n dj |}t |S )zConvert a network format IPv6 address into text. @param address: the binary address @type address: string @rtype: string @raises ValueError: the address isn't 16 bytes long z IPv6 addresses are 16 bytes longr Nr F 0T s ffffs ::s ::ffff: :)len ValueErrorbinasciiZhexlify _leading_zeromatchgroupappendr dnsipv4 inet_ntoajoinr )addresshexchunksilchunkmZ best_startZbest_lenstartZ last_was_zeroendZ current_lenprefix r$ /usr/lib/python3.6/ipv6.pyr s^ r s (.*):(\d+\.\d+\.\d+\.\d+)$s ::.*s .*::$c C s t | ts| j } | dkr d} tj| }|dk rvttjj|j d}d|j dj |d |d |d |d f j } t j| }|dk r| dd } n t j| }|dk r| dd } | j d }t|}|d krtjjd }g }x|D ]}|d kr.|r tjjd }xftdd | d D ]}|jd qW qt|} | dkrHtjj| dkrbdd| | }|j| qW |d k r| rtjjd j|} y tj| S tjtfk r tjjY nX dS )zConvert a text format IPv6 address into network format. @param text: the textual address @type text: string @rtype: string @raises dns.exception.SyntaxError: the text was not properly formatted s ::s 0::N z%s:%02x%02x:%02x%02xr r r r F Ts 0000r r r ) isinstancer encode _v4_endingr bytearrayr r inet_atonr decode_colon_colon_start_colon_colon_endsplitr Z exception SyntaxErrorr r r r Z unhexlifyError TypeError) textr br r Z seen_emptyZ canonicalcr Zlcr$ r$ r% r- b sR r- s c C s | j tS )N) startswith_mapped_prefix)r r$ r$ r% is_mapped s r< s s )__doc__rer Z dns.exceptionr Zdns.ipv4Z_compatr r r compiler r r+ r/ r0 r- r; r< r$ r$ r$ r% <module> s C GPK g\d rN N % __pycache__/ipv4.cpython-36.opt-1.pycnu [ 3 bW @ s4 d Z ddlZddlZddlmZ dd Zdd ZdS ) zIPv4 helper functions. N ) binary_typec C sJ t | dkrtjjt| ts&t| } d| d | d | d | d f j S )zConvert an IPv4 address in network form to text form. @param address: The IPv4 address @type address: string @returns: string z %u.%u.%u.%ur r )lendns exception SyntaxError isinstance bytearrayencode)Zaddress r /usr/lib/python3.6/ipv4.py inet_ntoa s r c C s t | ts| j } | jd}t|dkr0tjjx<|D ]4}|j sJtjjt|dkr6|d dkr6tjjq6W y dd |D }t j d | S tjjY nX d S ) zConvert an IPv4 address in text form to network form. @param text: The IPv4 address @type text: string @returns: string .r r r 0c S s g | ] }t |qS r )int).0partr r r <listcomp>8 s z inet_aton.<locals>.<listcomp>BBBBN)r ) r r r splitr r r r isdigitstructpack)textpartsr bytesr r r inet_aton% s r )__doc__r Z dns.exceptionr Z_compatr r r r r r r <module> s PK g\_DBI I ) __pycache__/__init__.cpython-36.opt-1.pycnu [ 3 bW/ # @ sR d Z ddddddddd d d d d ddddddddddddddd d d d d d!d"d#g#Zd$S )%zdnspython DNS toolkitZdnssecZe164ZednsZentropyZ exceptionflagshashZinetZipv4Zipv6messagenameZnamedictZnodeZopcodeZqueryZrcodeZrdataZ rdataclassZrdatasetZ rdatatypeZrendererZresolverZ reversenameZrrsetsetZ tokenizerZtsigZ tsigkeyringZttlZrdtypesupdateversionZwiredataZzoneN)__doc____all__ r r /usr/lib/python3.6/__init__.py<module> sF PK g\i?N% N% # __pycache__/rdataset.cpython-36.pycnu [ 3 bW$- @ s d Z ddlZddlmZ ddlZddlZddlZddlZddl Zddl Zddl m Z ej jZG dd dejjZG dd d ejjZG d d d ej jZd d Zdd Zdd Zdd ZdS )zHDNS rdatasets (an rdataset is a set of rdatas of a given type and class) N)StringIO ) string_typesc @ s e Zd ZdZdS )DifferingCoversz~An attempt was made to add a DNS SIG/RRSIG whose covered type is not the same as that of the other rdatas in the rdataset.N)__name__ __module__ __qualname____doc__ r r /usr/lib/python3.6/rdataset.pyr ! s r c @ s e Zd ZdZdS )IncompatibleTypesz?An attempt was made to add DNS RR data of an incompatible type.N)r r r r r r r r r ' s r c s e Zd ZdZddddgZejjf fdd Z fdd Z d d Z d$ fd d Z fddZ fddZ fddZdd Zdd Z fddZdd Zd%d d Zd&d d!Zd"d# Z ZS )'Rdataseta A DNS rdataset. @ivar rdclass: The class of the rdataset @type rdclass: int @ivar rdtype: The type of the rdataset @type rdtype: int @ivar covers: The covered type. Usually this value is dns.rdatatype.NONE, but if the rdtype is dns.rdatatype.SIG or dns.rdatatype.RRSIG, then the covers value will be the rdata type the SIG/RRSIG covers. The library treats the SIG and RRSIG types as if they were a family of types, e.g. RRSIG(A), RRSIG(NS), RRSIG(SOA). This makes RRSIGs much easier to work with than if RRSIGs covering different rdata types were aggregated into a single RRSIG rdataset. @type covers: int @ivar ttl: The DNS TTL (Time To Live) value @type ttl: int rdclassrdtypecoversttlc s* t t| j || _|| _|| _d| _dS )zCreate a new rdataset of the specified class and type. @see: the description of the class instance variables for the meaning of I{rdclass} and I{rdtype}r N)superr __init__r r r r )selfr r r ) __class__r r r C s zRdataset.__init__c s2 t t| j }| j|_| j|_| j|_| j|_|S )N)r r _cloner r r r )r obj)r r r r O s zRdataset._clonec C s( t | dkr|| _n|| jk r$|| _dS )zSet the TTL of the rdataset to be the lesser of the set's current TTL or the specified TTL. If the set contains no rdatas, set the TTL to the specified TTL. @param ttl: The TTL @type ttl: intr N)lenr )r r r r r update_ttlW s zRdataset.update_ttlNc s | j |j ks| j|jkr t|dk r.| j| | jtjjksJ| jtjjkr|j }t | dkrt| jtjj krt|| _n| j|krt tjj |jrt | dkr| j tt| j| dS )a% Add the specified rdata to the rdataset. If the optional I{ttl} parameter is supplied, then self.update_ttl(ttl) will be called prior to adding the rdata. @param rd: The rdata @type rd: dns.rdata.Rdata object @param ttl: The TTL @type ttl: intNr )r r r r dns rdatatypeZRRSIGZSIGr r NONEr Z is_singletonclearr r add)r rdr r )r r r r c s z Rdataset.addc s | j |j tt| j| d S )N)r r r r union_update)r other)r r r r s zRdataset.union_updatec s | j |j tt| j| d S )N)r r r r intersection_update)r r! )r r r r" s z Rdataset.intersection_updatec s | j |j tt| j| dS )zAdd all rdatas in other to self. @param other: The rdataset from which to update @type other: dns.rdataset.Rdataset objectN)r r r r update)r r! )r r r r# s zRdataset.updatec C sR | j dkrd}ndtjj| j d }dtjj| j d tjj| j | d S )Nr ()z<DNS z rdataset>)r r r to_text rdataclassr r )r Zctextr r r __repr__ s zRdataset.__repr__c C s | j S )N)r( )r r r r __str__ s zRdataset.__str__c sF t |tsdS | j|jks2| j|jks2| j|jkr6dS tt| j|S )zTwo rdatasets are equal if they have the same class, type, and covers, and contain the same rdata. @rtype: boolF) isinstancer r r r r __eq__)r r! )r r r r- s zRdataset.__eq__c C s | j | S )N)r- )r r! r r r __ne__ s zRdataset.__ne__Tc K s |dk r"|j ||}t|}d}nd}d}t }|dk r>|} n| j} t| dkrz|jd||tjj| tj j| j f nNxL| D ]D} |jd||| j tjj| tj j| j | jf ||d|f qW |j dd S ) a Convert the rdataset into DNS master file format. @see: L{dns.name.Name.choose_relativity} for more information on how I{origin} and I{relativize} determine the way names are emitted. Any additional keyword arguments are passed on to the rdata to_text() method. @param name: If name is not None, emit a RRs with I{name} as the owner name. @type name: dns.name.Name object @param origin: The origin for relative names, or None. @type origin: dns.name.Name object @param relativize: True if names should names be relativized @type relativize: boolNr' r$ r z %s%s%s %s z%s%s%d %s %s %s )origin relativizer ) Zchoose_relativitystrr r r writer r) r( r r r getvalue) r namer/ r0 override_rdclasskwZntextZpadsr r r r r r( s* zRdataset.to_textc C s& |dk r|}d}n| j }|jdd t| dkr`|j||| tjd| j|dd}|j| dS |rxt| } t j | n| } x| D ]} |j||| tjd| j|| j d}|j| |j } | j||| |j } | | dk st |j| d tjd| | }|j| |jdd qW t| S dS ) a, Convert the rdataset to wire format. @param name: The owner name of the RRset that will be emitted @type name: dns.name.Name object @param file: The file to which the wire format data will be appended @type file: file @param compress: The compression table to use; the default is None. @type compress: dict @param origin: The origin to be appended to any relative names when they are emitted. The default is None. @returns: the number of records emitted @rtype: int NFr z!HHIHr i z!H)r seekr to_wirestructpackr r3 listrandomZshuffler tellAssertionError) r r5 filecompressr/ r6 Z want_shuffler Zstufflr startendr r r r; s8 zRdataset.to_wirec C s& | j |kr"| j|kr"| j|kr"dS dS )zSReturns True if this rdataset matches the specified class, type, and coversTF)r r r )r r r r r r r match s zRdataset.match)N)NNTN)NNNT)r r r r __slots__r r r r r r r r r" r# r* r+ r- r. r( r; rG __classcell__r r )r r r , s$ 2 /r c C sp t | trtjj| } t |tr,tjj|}t| |}|j| x*|D ]"}tjj|j |j |}|j | qFW |S )zCreate an rdataset with the specified class, type, and TTL, and with the specified list of rdatas in text format. @rtype: dns.rdataset.Rdataset object ) r, r r r) from_textr r r Zrdatar r r )r r r text_rdatasrtr r r r from_text_list s rN c G s t | |||S )zCreate an rdataset with the specified class, type, and TTL, and with the specified rdatas in text format. @rtype: dns.rdataset.Rdataset object )rN )r r r rK r r r rJ / s rJ c C sT t |dkrtdd}x6|D ].}|dkrBt|j|j}|j| |j| q W |S )zCreate an rdataset with the specified TTL, and with the specified list of rdata objects. @rtype: dns.rdataset.Rdataset object r z rdata list must not be emptyN)r ValueErrorr r r r r )r rdatasrL r r r r from_rdata_list9 s rQ c G s t | |S )zCreate an rdataset with the specified TTL, and with the specified rdata objects. @rtype: dns.rdataset.Rdataset object )rQ )r rP r r r from_rdataK s rR )r r? ior r< Z dns.exceptionr Z dns.rdatatypeZdns.rdataclassZ dns.rdataZdns.setZ_compatr setSetZ SimpleSetZ exceptionZ DNSExceptionr r r rN rJ rQ rR r r r r <module> s$ q PK g\-^L __pycache__/hash.cpython-36.pycnu [ 3 bWL @ sX d Z ddlZi Zejed< ejed< ejed< ejed< ejed< ejed< d d Z dS ) z'Hashing backwards compatibility wrapper NZMD5ZSHA1ZSHA224ZSHA256ZSHA384ZSHA512c C s t | j S )N)hashesupper) algorithm r /usr/lib/python3.6/hash.pyget s r ) __doc__Zhashlibr Zmd5Zsha1Zsha224Zsha256Zsha384Zsha512r r r r r <module> s PK g\pJն ' __pycache__/update.cpython-36.opt-1.pycnu [ 3 bW ' @ s` d Z ddlZddlZddlZddlZddlZddlZddlZddl m Z G dd dej j Z dS )zDNS Dynamic Update Support N ) string_typesc sx e Zd Zejjddejjf fdd ZdddZ dd Z dd Z d d Z d d Z dd ZdddZd fdd Z ZS )UpdateNc s t t| j | jtjjtjjO _t|t r>tj j |}|| _ t|t rZtj j |}|| _| j| j| j |tjjddd |dk r| j|||d dS )a Initialize a new DNS Update object. @param zone: The zone which is being updated. @type zone: A dns.name.Name or string @param rdclass: The class of the zone; defaults to dns.rdataclass.IN. @type rdclass: An int designating the class, or a string whose value is the name of a class. @param keyring: The TSIG keyring to use; defaults to None. @type keyring: dict @param keyname: The name of the TSIG key to use; defaults to None. The key must be defined in the keyring. If a keyring is specified but a keyname is not, then the key used will be the first key in the keyring. Note that the order of keys in a dictionary is not defined, so applications should supply a keyname when a keyring is used, unless they know the keyring contains only one key. @type keyname: dns.name.Name or string @param keyalgorithm: The TSIG algorithm to use; defaults to dns.tsig.default_algorithm. Constants for TSIG algorithms are defined in dns.tsig, and the currently implemented algorithms are HMAC_MD5, HMAC_SHA1, HMAC_SHA224, HMAC_SHA256, HMAC_SHA384, and HMAC_SHA512. @type keyalgorithm: string T)ZcreateZ force_uniqueN) algorithm)superr __init__flagsdnsZopcodeZto_flagsZUPDATE isinstancer name from_textorigin rdataclass zone_rdclass find_rrsetZquestion rdatatypeZSOAZuse_tsig)selfZzoneZrdclassZkeyringZkeynameZ keyalgorithm) __class__ /usr/lib/python3.6/update.pyr s zUpdate.__init__c C sB |dkr| j }|j }| j||| j|j||dd}|j|| dS )z&Add a single RR to the update section.NT) authoritycoversr r rdtypeadd)r r ttlrdZdeletingsectionr Zrrsetr r r _add_rrE s zUpdate._add_rrc G s: t |trtjj|d}t |d tjjrnx@|D ]8}|rF| j||j x |D ]}| j ||j ||d qLW q0W nt |}t |j d}t |d tjjr|r| j||d j x|D ]}| j ||||d qW nh|j d}t |trtjj|}|r| j|| x6|D ].} tjj| j|| | j}| j ||||d qW dS )a Add records. The first argument is the replace mode. If false, RRs are added to an existing RRset; if true, the RRset is replaced with the specified contents. The second argument is the section to add to. The third argument is always a name. The other arguments can be: - rdataset... - ttl, rdata... - ttl, rdtype, string...Nr )r )r r r r r rdatasetRdatasetdeleter r r listintpoprdataRdatar r r ) r replacer r argsrdsr r r sr r r _addO s0 z Update._addc G s | j d| j|f| dS )zAdd records. The first argument is always a name. The other arguments can be: - rdataset... - ttl, rdata... - ttl, rdtype, string...FN)r* r )r r r' r r r r w s z Update.addc G sf t |trtjj|d}t|dkrR| j| j|tjj tj j tj j tj j dd nt |d tj j rx|D ]&}x |D ]}| j|d|tjj qtW qjW nt|}t |d tjjrx|D ]}| j|d|tjj qW n|jd}t |trtj j|}t|dkr(| j| j|| j|tj j tjj dd n:x8|D ]0}tjj| j||| j}| j|d|tjj q.W dS )zDelete records. The first argument is always a name. The other arguments can be: - I{nothing} - rdataset... - rdata... - rdtype, [string...]Nr T)r r r r r lenr r r ANYr NONEr r r r! r$ r% r# r r )r r r' r( r r r) r r r r s6 z Update.deletec G s | j d| j|f| dS )aQ Replace records. The first argument is always a name. The other arguments can be: - rdataset... - ttl, rdata... - ttl, rdtype, string... Note that if you want to replace the entire node, you should do a delete of the name followed by one or more calls to add.TN)r* r )r r r' r r r r& s zUpdate.replacec G s t |trtjj|d}t|dkrL| j| j|tjj tj j tj j ddd nt |d tj j s|t |d tjjs|t|dkrt |d tj j st|}|jdd | jd| j|f| n@|d }t |trtj j|}| j| j|tjj |tj j ddd dS )aB Require that an owner name (and optionally an rdata type, or specific rdataset) exists as a prerequisite to the execution of the update. The first argument is always a name. The other arguments can be: - rdataset... - rdata... - rdtype, string...Nr Tr F)r r r r r r+ r answerr r, r r- r r r$ r% r! insertr* )r r r' r r r r present s* zUpdate.presentc C s t |trtjj|d}|dkrH| j| j|tjjtj j tj jddd n8t |tr^tj j|}| j| j|tjj|tj jddd dS )zRequire that an owner name (and optionally an rdata type) does not exist as a prerequisite to the execution of the update.NT) r r r r r r r. r r- r r, )r r r r r r absent s z Update.absent c s |dkr| j }tt| j||S )zcReturn a string containing the update in DNS compressed wire format. @rtype: stringN)r r r to_wire)r r Zmax_size)r r r r3 s zUpdate.to_wire)NN)N)Nr2 )__name__ __module__ __qualname__r r INZtsigZdefault_algorithmr r r* r r r& r0 r1 r3 __classcell__r r )r r r s % ( +$ r )__doc__Z dns.messager Zdns.nameZ dns.opcodeZ dns.rdataZdns.rdataclassZ dns.rdatasetZdns.tsigZ_compatr messageZMessager r r r r <module> s PK g\zu-\* \* ' __pycache__/dnssec.cpython-36.opt-1.pycnu [ 3 bW9 @ sH d Z ddlmZ ddlZddlZddlZddlZddlZddl Zddl Zddl Zddl Zddl ZddlmZ G dd dejjZG dd d ejjZdZd Zd Zd Zd ZdZdZdZdZ dZ dZ dZ dZ dZ!eeeeeeeee e e e e e!dZ"e#dd e"j$ D Z%dd Z&d d Z'd d Z(dDd d!Z)dEd"d#Z*d$d% Z+d&d' Z,d(d) Z-d*d+ Z.d,d- Z/d.d/ Z0d0d1 Z1d2d3 Z2d4d5 Z3d6d7 Z4d8d9 Z5dFd:d;Z6dGd<d=Z7d>d? Z8y(ddl9Z:ddl;Z:ddl<Z:e7Z=e6Z>d@Z?W n" e@k r e8Z=e8Z>dAZ?Y nX y8ddlAZAddlBZAddlCZAddlDZAd@ZEG dBdC dCeFZGW n e@k rB dAZEY nX dS )Hz.Common DNSSEC-related functions and constants. )BytesION ) string_typesc @ s e Zd ZdZdS )UnsupportedAlgorithmz&The DNSSEC algorithm is not supported.N)__name__ __module__ __qualname____doc__ r r /usr/lib/python3.6/dnssec.pyr ! s r c @ s e Zd ZdZdS )ValidationFailurez The DNSSEC signature is invalid.N)r r r r r r r r r & s r )RSAMD5DHDSAECCRSASHA1 DSANSEC3SHA1RSASHA1NSEC3SHA1 RSASHA256 RSASHA512INDIRECTECDSAP256SHA256ECDSAP384SHA384 PRIVATEDNS PRIVATEOIDc c s | ]\}}||fV qd S )Nr ).0xyr r r <genexpr>N s r+ c C s" t j| j }|dkr t| }|S )z:Convert text into a DNSSEC algorithm value @rtype: intN)_algorithm_by_textgetupperint)textvaluer r r algorithm_from_textQ s r2 c C s t j| }|dkrt| }|S )z;Convert a DNSSEC algorithm value to text @rtype: stringN)_algorithm_by_valuer- str)r1 r0 r r r algorithm_to_text[ s r5 c C s t }| j||d |j S )N)origin)r to_wiregetvalue)recordr6 sr r r _to_rdatae s r; c C s t | |}t|}| jtkr0|d d> |d S d}x<tt|d D ](}||d| d> |d| d 7 }qFW t|d dkr||t|d d> 7 }||d? d@ 7 }|d@ S d S ) Nr r r r r i )r; bytearray algorithmr rangelen)keyr6 rdataZtotalir r r key_idk s rF c C s |j dkr d}tjjd }n,|j dkr@d}tjjd }n td| t| trdtjj| |} |j | j j |j t || |j }tjdt||j|| }tjjtjjtjj|dt|S )NSHA1r SHA256r zunsupported algorithm "%s"z!HBBr )r. dnshashhashesr isinstancer name from_textupdateZ canonicalizer7 r; digeststructpackrF r@ rD Z from_wire rdataclassIN rdatatypeZDSrB )rM rC r@ r6 ZdsalgrJ rP Zdsrdatar r r make_ds{ s rV c C s g }| j |j}|d kr d S t|tjjrZy|jtjjtj j }W q^ t k rV d S X n|}x0|D ](}|j |j krdt ||jkrd|j| qdW |S )N)r- signerrL rI ZnodeZNodeZ find_rdatasetrS rT rU ZDNSKEYKeyErrorr@ rF Zkey_tagappend)keysrrsigZcandidate_keysr1 rdatasetrD r r r _find_candidate_keys s r] c C s | t ttttfkS )N)r r r r! r" )r@ r r r _is_rsa s r^ c C s | t tfkS )N)r r )r@ r r r _is_dsa s r_ c C s t o| ttfkS )N) _have_ecdsar$ r% )r@ r r r _is_ecdsa s ra c C s | t kS )N)r )r@ r r r _is_md5 s rb c C s | t tttfkS )N)r r r r )r@ r r r _is_sha1 s rc c C s | t tfkS )N)r! r$ )r@ r r r _is_sha256 s rd c C s | t kS )N)r% )r@ r r r _is_sha384 s re c C s | t kS )N)r" )r@ r r r _is_sha512 s rf c C s~ t | rtjjd S t| r,tjjd S t| rBtjjd S t| rXtjjd S t| rntjjd S td| d S )NZMD5rG rH ZSHA384ZSHA512z unknown hash for algorithm %u) rb rI rJ rK rc rd re rf r )r@ r r r _make_hash s rg c C s t | r ddddddddg}ndt| r6dd d dd g}nLt| rVd ddd dd ddd g }n,t| rvd ddd dd ddd g }n td| t|}t| j}dgd| | g d|d g d|g | ddg d|g }tj dt| f| S )N* H r r r + r r ` r e r zunknown algorithm %u0 r r r z!%dB) rb rc rd rf r rB rg Z digest_sizerQ rR )r@ ZoidZolenZdlenZidbytesr r r _make_algorithm_id s <rq c ) C s t |tr tjj|tjj}xt||D ]}|s<tdt | trX| d }| d }n | j}| }|dkrrt j }|j |k rtd|j |krtdt |j }t|j r`|j} tjd| dd \} | dd } | dkr tjd| dd \} | d d } | d| } | | d } t| d } tjjjtjjj| tjjj| f}tjjj|jf}nt|j rj|j} tjd| dd \}| dd } d |d }| dd }| d d } | d| }| |d } | d| }| |d } | d| }tjj jtjjj|tjjj|tjjj|tjjj|f}tjd |jdd \}}tjjj|tjjj|f}nt |j rX|j t krt j j!}d}n"|j t"krt j j#}d}ntd|j} tjjj| d| }tjjj| ||d }t j$j%|j&|||j'} t j(j)j*| |} t+| |}|jd| } |j|d } t j j,tjjj| tjjj| }ntd|j |j-t.||dd |j-|j/j0| |j1t|d k r|j2|j1d d } tjjd| }|j0|}!tj3d|j4|j5|j6}"t7|}#xP|#D ]H}$|j-|! |j-|" |$j0|}%tj3dt|%}&|j-|& |j-|% qW |j8 }'t|j rt9|j |' }'| d t|' d }(tj3dd |( d fddgdg|( dg |' }'n(t|j st |j rntd|j |j:|'|r*dS q*W tddS )a Validate an RRset against a single signature rdata The owner name of the rrsig is assumed to be the same as the owner name of the rrset. @param rrset: The RRset to validate @type rrset: dns.rrset.RRset or (dns.name.Name, dns.rdataset.Rdataset) tuple @param rrsig: The signature rdata @type rrsig: dns.rrset.Rdata @param keys: The key dictionary. @type keys: a dictionary keyed by dns.name.Name with node or rdataset values @param origin: The origin to use for relative names @type origin: dns.name.Name or None @param now: The time to use when validating the signatures. The default is the current time. @type now: int z unknown keyr r NZexpiredz not yet validz!Bz!Hr r @ z!20s20s rp zunknown ECDSA curvezunknown algorithm %u *z!HHIr z!%dB zverify failure);rL r rI rM rN rootr] r tupletimeZ expirationZ inceptionrg r@ r^ rC rQ unpackrB CryptoZ PublicKeyZRSAZ constructUtilnumber bytes_to_longZ signaturer_ r ra r$ ecdsaZcurvesZNIST256pr% ZNIST384pZ ellipticcurveZPointcurveorderrZ Z VerifyingKeyZfrom_public_point ECKeyWrapperZ SignaturerO r; rW Z to_digestableZlabelssplitrR ZrdtypeZrdclassZ original_ttlsortedrP rq verify))rrsetr[ rZ r6 nowZ candidate_keyrrnamer\ rJ ZkeyptrZbytes_Zrsa_eZrsa_nZkeylenpubkeysigtZoctetsZdsa_qZdsa_pZdsa_gZdsa_yZdsa_rZdsa_sr key_lenr) r* ZpointZ verifying_keyrr: suffixZ rrnamebufZrrfixedZrrlistZrrZrrdataZrrlenrP Zpadlenr r r _validate_rrsig s " r c C s t |tr tjj|tjj}t | tr0| d }n| j}t |trR|d }|d }n |j}|}|j|}|j|}||krtdx6|D ].}yt | |||| dS tk r Y qX qW tddS )ah Validate an RRset @param rrset: The RRset to validate @type rrset: dns.rrset.RRset or (dns.name.Name, dns.rdataset.Rdataset) tuple @param rrsigset: The signature RRset @type rrsigset: dns.rrset.RRset or (dns.name.Name, dns.rdataset.Rdataset) tuple @param keys: The key dictionary. @type keys: a dictionary keyed by dns.name.Name with node or rdataset values @param origin: The origin to use for relative names @type origin: dns.name.Name or None @param now: The time to use when validating the signatures. The default is the current time. @type now: int r r zowner names do not matchNzno RRSIGs validated) rL r rI rM rN rx ry Zchoose_relativityr r ) r ZrrsigsetrZ r6 r r Z rrsignameZ rrsigrdatasetr[ r r r _validatex s* r c O s t dd S )Nz#DNSSEC validation requires pycrypto)NotImplementedError)argskwargsr r r _need_pycrypto s r TFc @ s e Zd Zdd Zdd ZdS )r c C s || _ || _d S )N)rC r )selfrC r r r r __init__ s zECKeyWrapper.__init__c C s t jjj|}| jjj||S )N)r| r} r~ r rC r Zverifies)r rP r Zdiglongr r r r s zECKeyWrapper.verifyN)r r r r r r r r r r s r )N)N)NN)NN)Hr ior rQ rz Z dns.exceptionrI Zdns.hashZdns.nameZdns.nodeZ dns.rdatasetZ dns.rdataZ dns.rdatatypeZdns.rdataclassZ_compatr Z exceptionZ DNSExceptionr r r r r r r r r r! r" r$ r% r# r& r' r, dictitemsr3 r2 r5 r; rF rV r] r^ r_ ra rb rc rd re rf rg rq r r r ZCrypto.PublicKey.RSAr| ZCrypto.PublicKey.DSAZCrypto.Util.numberZvalidateZvalidate_rrsigZ_have_pycrypto ImportErrorr Z ecdsa.ecdsaZecdsa.ellipticcurveZ ecdsa.keysr` objectr r r r r <module> s 0 PK g\]5 5 __pycache__/query.cpython-36.pycnu [ 3 OfL @ s d Z ddlmZ ddlZddlZddlZddlZddlZddlZddl Z ddl Z ddl Z ddl Z ddlZ ddlZ ddlmZmZ ejd/kreZnejZejZG dd de jjZG d d d e jjZ d d Z d d Z dd Z dd Z dd Z!e"edre a#ne a#dd Z$dd Z%dd Z&d d Z'd d Z(d0d"d#Z)d$d% Z*d&d' Z+d(d) Z,d1d*d+Z-e j.j/e j0j1dd ddd,dddddd!e j2j3fd-d.Z4dS )2zTalk to a DNS server. ) generatorsN )long string_types c @ s e Zd ZdZdS )UnexpectedSourcez=A DNS query response came from an unexpected address or port.N)__name__ __module__ __qualname____doc__ r r /usr/lib/python3.6/query.pyr , s r c @ s e Zd ZdZdS ) BadResponsez<A DNS query response does not respond to the question asked.N)r r r r r r r r r 1 s r c C s | d kr d S t j | S d S )N)time)timeoutr r r _compute_expiration6 s r c C sj d}|r|t jO }|r |t jO }|r.|t jO }t j }|j| | |rZ|jt|d }n|j }t|S )aq Poll polling backend. @param fd: File descriptor @type fd: int @param readable: Whether to wait for readability @type readable: bool @param writable: Whether to wait for writability @type writable: bool @param timeout: Deadline timeout (expiration time, in seconds) @type timeout: float @return True on success, False on timeout r i )selectZPOLLINZPOLLOUTZPOLLERRpollregisterr bool)fdreadablewritableerrorr Z event_maskZpollableZ event_listr r r _poll_for= s r c C sr g g g }}}|r| g}|r$| g}|r.| g}|dkrLt j |||\}} } nt j ||||\}} } t|pn| pn| S )as Select polling backend. @param fd: File descriptor @type fd: int @param readable: Whether to wait for readability @type readable: bool @param writable: Whether to wait for writability @type writable: bool @param timeout: Deadline timeout (expiration time, in seconds) @type timeout: float @return True on success, False on timeout N)r r ) r r r r r ZrsetZwsetZxsetZrcountZwcountZxcountr r r _select_for\ s r c C s d}x|s|d krd }n |t j }|dkr4tjjy t| ||||sNtjjW n6 tk r } z|jd tjkrv|W Y d d }~X nX d}qW d S )NFg r T) r dns exceptionZTimeout_polling_backend select_errorargserrnoZEINTR)r r r r expirationdoner er r r _wait_fory s r% c C s | a dS )z# Internal API. Do not use. N)r )fnr r r _set_polling_backend s r' r c C s t | ddd| d S )NTF)r% )sr" r r r _wait_for_readable s r) c C s t | ddd| d S )NFT)r% )r( r" r r r _wait_for_writable s r* c C sD t jj| |d }t jj| |d }||koB|dd |dd kS )Nr r )r inetZ inet_pton)afZa1Za2Zn1Zn2r r r _addresses_equal s r- c C s` |sdS t | ||s<tjj|d r@|dd |dd kr@dS |rHdS td| d| d S )NTr r Fzgot a response from z instead of )r- r r+ Z is_multicastr )r, from_address destinationignore_unexpectedr r r _matches_destination s (r1 c C s | d kr6yt jj|} W n tk r4 t jj} Y nX | t jjkrp||f}|d k sZ|dkr|d krfd}||f}n@| t jjkr||ddf}|d k s|dkr|d krd}||ddf}| ||fS )Nr z0.0.0.0z::)r r+ Zaf_for_address ExceptionZAF_INETZAF_INET6)r, whereportsource source_portr/ r r r _destination_and_source s$ r7 5 Fc C s" | j } t|||||\}} }t|tjd} d} zt|}| jd |dk rV| j| t| | t j } | j | | xt | | | j d\} }t | j|| |sqvt j | }y"tjj| | j| j|d}||_ W n tk r | rwvn Y nX | j| r|S | rqvqvtqvW W d| j X dS )a Return the response obtained after sending a query via UDP. @param q: the query @type q: dns.message.Message @param where: where to send the message @type where: string containing an IPv4 or IPv6 address @param timeout: The number of seconds to wait before the query times out. If None, the default, wait forever. @type timeout: float @param port: The port to which to send the message. The default is 53. @type port: int @param af: the address family to use. The default is None, which causes the address family to use to be inferred from the form of where. If the inference attempt fails, AF_INET is used. @type af: int @rtype: dns.message.Message object @param source: source address. The default is the wildcard address. @type source: string @param source_port: The port from which to send the message. The default is 0. @type source_port: int @param ignore_unexpected: If True, ignore responses from unexpected sources. The default is False. @type ignore_unexpected: bool @param one_rr_per_rrset: Put each RR into its own RRset @type one_rr_per_rrset: bool r Ni )keyring request_macone_rr_per_rrset)to_wirer7 socket_factorysocket SOCK_DGRAMr setblockingbindr* r Zsendtor) recvfromr1 Zfamilyr message from_wirer9 macr2 is_responser close)qr3 r r4 r, r5 r6 r0 r; ignore_errorswirer/ r( begin_timer" r. response_timerr r r udp sD rN c C sJ d}x@|dkrDt | | | j|}|dkr.t|t| }|| }qW |S )zRead the specified number of bytes from sock. Keep trying until we either get the desired amount, or we hit EOF. A Timeout exception will be raised if the operation is not completed by the expiration time. r )r) ZrecvEOFErrorlen)sockcountr" r( nr r r _net_read s rU c C s> d}t |}x,||k r8t| | || j||d 7 }qW dS )zWrite the specified data to the socket. A Timeout exception will be raised if the operation is not completed by the expiration time. r N)rQ r* send)rR datar" Zcurrentlr r r _net_write/ s rY c C sp y| j | W n\ tjk rj tj d d \}}t|drF|j}n|d }|tjtjtj gkrf|Y nX d S )N r! r ) Zconnectr> r sysexc_infohasattrr! Z EINPROGRESSZ EWOULDBLOCKZEALREADY)r( ZaddressZtyvZv_errr r r _connect; s r_ c C s | j }t|||||\}} }t|tjd} d} zt|} | jd tj } |dk r^| j| t | | t |} t j d| | }t | || t| d| }t jd|\} t| | | }W d| dkrd}n tj | }| j X tjj|| j| j|d}||_| j|st|S )a Return the response obtained after sending a query via TCP. @param q: the query @type q: dns.message.Message object @param where: where to send the message @type where: string containing an IPv4 or IPv6 address @param timeout: The number of seconds to wait before the query times out. If None, the default, wait forever. @type timeout: float @param port: The port to which to send the message. The default is 53. @type port: int @param af: the address family to use. The default is None, which causes the address family to use to be inferred from the form of where. If the inference attempt fails, AF_INET is used. @type af: int @rtype: dns.message.Message object @param source: source address. The default is the wildcard address. @type source: string @param source_port: The port from which to send the message. The default is 0. @type source_port: int @param one_rr_per_rrset: Put each RR into its own RRset @type one_rr_per_rrset: bool r Nz!HrZ )r9 r: r; )r< r7 r= r> SOCK_STREAMr r@ r rA r_ rQ structpackrY rU unpackrG r rC rD r9 rE rF r )rH r3 r r4 r, r5 r6 r; rJ r/ r( rK r" rX tcpmsgldatarL rM r r r tcpI s8 rf Tc & c s t |trtjj|}t |tr,tjj|}tjj|||}|tjjkrltj j|dddd| }|j j | |dk r|j |||d |j }t| | || | \} }} |r|tjjkrtdt| tjd}nt| tjd}|jd | dk r|j| t| }t|| t|}|r*t|| |j| n tj d|| }t ||| d }d }d }d}|rj|} tjj } nd} |} d} d } x6|st|} | dks|dk r| |kr|} |rt || |j d \}}!n&t!|d | }"tj"d|"\}t!||| }|tjjk}#tjj#||j$|j%d | | d | |#d }$|$j&} d } d}%|dkr|$j' sV|$j'd j| krbtj(j)d|$j'd }|j*tjj+krtj(j)dd}%|j, }|tjjkr|d j-| krd }nd }x|$j'|%d D ]}|rtj(j)d|j*tjj+krl|j| krl|r&|d j-| kr tj(j)dd }n|tjjkr:| }||kr~|tjj.ksf|tjjkr~|r~d }n|rtjj.}d }qW |r|j$r|$j/ rtj(j)d|$V q~W |j0 dS )a Return a generator for the responses to a zone transfer. @param where: where to send the message @type where: string containing an IPv4 or IPv6 address @param zone: The name of the zone to transfer @type zone: dns.name.Name object or string @param rdtype: The type of zone transfer. The default is dns.rdatatype.AXFR. @type rdtype: int or string @param rdclass: The class of the zone transfer. The default is dns.rdataclass.IN. @type rdclass: int or string @param timeout: The number of seconds to wait for each response message. If None, the default, wait forever. @type timeout: float @param port: The port to which to send the message. The default is 53. @type port: int @param keyring: The TSIG keyring to use @type keyring: dict @param keyname: The name of the TSIG key to use @type keyname: dns.name.Name object or string @param relativize: If True, all names in the zone will be relativized to the zone origin. It is essential that the relativize setting matches the one specified to dns.zone.from_xfr(). @type relativize: bool @param af: the address family to use. The default is None, which causes the address family to use to be inferred from the form of where. If the inference attempt fails, AF_INET is used. @type af: int @param lifetime: The total number of seconds to spend doing the transfer. If None, the default, then there is no limit on the time the transfer may take. @type lifetime: float @rtype: generator of dns.message.Message objects. @param source: source address. The default is the wildcard address. @type source: string @param source_port: The port from which to send the message. The default is 0. @type source_port: int @param serial: The SOA serial number to use as the base for an IXFR diff sequence (only meaningful if rdtype == dns.rdatatype.IXFR). @type serial: int @param use_udp: Use UDP (only meaningful for IXFR) @type use_udp: bool @param keyalgorithm: The TSIG algorithm to use; defaults to dns.tsig.default_algorithm @type keyalgorithm: string r INSOAz. . %u 0 0 0 0N) algorithmzcannot do a UDP AXFRz!HFTi rZ )r9 r: xfrorigintsig_ctxZmultifirstr; z No answer or RRset not for qnamezfirst RRset is not an SOAr zanswers after final SOAzIXFR base serial mismatchz missing TSIG)1 isinstancer r nameZ from_text rdatatyperC Z make_queryZIXFRrrsetZ authorityappendZuse_tsigr< r7 ValueErrorr= r> r? r` r@ rA r r_ rQ r* rV ra rb rY emptyr) rB rU rc rD r9 rE rl Zanswerr FormErrorrdtyperh copyserialAXFRZhad_tsigrG )&r3 Zzonerv Zrdclassr r4 r9 ZkeynameZ relativizer, Zlifetimer5 r6 rx Zuse_udpZ keyalgorithmrH rq rJ r/ r( r" rX rd r# Z delete_modeZ expecting_SOAZ soa_rrsetrk Zonamerl rm Z mexpirationr. re Zis_ixfrrM Z answer_indexr r r rj s 5 rj )r )Nr8 NNr FFF)Nr8 NNr F)5r Z __future__r r! r r> ra r[ r Z dns.exceptionr Zdns.inetZdns.nameZ dns.messageZdns.rdataclassZ dns.rdatatypeZ_compatr r version_infoOSErrorr r r= r Z DNSExceptionr ru r r r r r% r' r] r r) r* r- r1 r7 rN rU rY r_ rf rp ry Z rdataclassrg ZtsigZdefault_algorithmrj r r r r <module> sX I ? PK g\Yҹu u __pycache__/zone.cpython-36.pycnu [ 3 ӕWZ @ sN d Z ddlmZ ddlZddlZddlZddlmZ ddlZ ddl Z ddl Z ddl Z ddl Z ddlZ ddlZ ddlZ ddlZ ddlZ ddlmZmZ ejd kZG dd d e jjZG d d d eZG d d d eZ G dd deZ G dd de Z G dd de Z de j!j"de dddfddZ#de j!j"de dddfddZ$e ddfddZ%dS ) z DNS Zones. ) generatorsN)BytesIO ) string_types text_type c @ s e Zd ZdZdS )BadZonezThe DNS zone is malformed.N)__name__ __module__ __qualname____doc__ r r /usr/lib/python3.6/zone.pyr ) s r c @ s e Zd ZdZdS )NoSOAz)The DNS zone has no SOA RR at its origin.N)r r r r r r r r r . s r c @ s e Zd ZdZdS )NoNSz+The DNS zone has no NS RRset at its origin.N)r r r r r r r r r 3 s r c @ s e Zd ZdZdS ) UnknownOriginz!The DNS zone's origin is unknown.N)r r r r r r r r r 8 s r c @ sj e Zd ZdZejjZddddgZej j dfddZ d d Z d d Z d d Zdd Zdd Zdd Zdd Zdd Zdd Zdd Zd d Zd d ZeZd!d" Zd#d$ ZdCd&d'ZdDd(d)Z d*d+ Z ej j d%fd,d-Z ej j d%fd.d/Z!ej j fd0d1Z"d2d3 Z#ej j fd4d5Z$ej j fd6d7Z%ej j&ej j fd8d9Z'ej j&ej j fd:d;Z(dEd=d>Z)dFd?d@Z*dAdB Z+d<S )GZoneaZ A DNS zone. A Zone is a mapping from names to nodes. The zone object may be treated like a Python dictionary, e.g. zone[name] will retrieve the node associated with that name. The I{name} may be a dns.name.Name object, or it may be a string. In the either case, if the name is relative it is treated as relative to the origin of the zone. @ivar rdclass: The zone's rdata class; the default is class IN. @type rdclass: int @ivar origin: The origin of the zone. @type origin: dns.name.Name object @ivar nodes: A dictionary mapping the names of nodes in the zone to the nodes themselves. @type nodes: dict @ivar relativize: should names in the zone be relativized? @type relativize: bool @cvar node_factory: the factory used to create a new node @type node_factory: class or callable rdclassoriginnodes relativizeTc C sb |dk rFt |tr tjj|}nt |tjjs6td|j sFtd|| _|| _ i | _ || _ dS )zInitialize a zone object. @param origin: The origin of the zone. @type origin: dns.name.Name object @param rdclass: The zone's rdata class; the default is class IN. @type rdclass: intNz2origin parameter must be convertible to a DNS namez)origin parameter must be an absolute name) isinstancer dnsname from_textName ValueError is_absoluter r r r )selfr r r r r r __init__Y s z Zone.__init__c C s: t |tsdS | j|jks2| j|jks2| j|jkr6dS dS )ziTwo zones are equal if they have the same origin, class, and nodes. @rtype: bool FT)r r r r r )r otherr r r __eq__n s z Zone.__eq__c C s | j | S )z6Are two zones not equal? @rtype: bool )r! )r r r r r __ne__| s z Zone.__ne__c C sb t |trtjj|d }nt |tjjs0td|j r^|j| j sLtd| j r^|j | j }|S )Nz0name parameter must be convertible to a DNS namez5name parameter must be a subdomain of the zone origin) r r r r r r KeyErrorr is_subdomainr r )r r r r r _validate_name s zZone._validate_namec C s | j |}| j| S )N)r% r )r keyr r r __getitem__ s zZone.__getitem__c C s | j |}|| j|< d S )N)r% r )r r& valuer r r __setitem__ s zZone.__setitem__c C s | j |}| j|= d S )N)r% r )r r& r r r __delitem__ s zZone.__delitem__c C s | j j S )N)r __iter__)r r r r r+ s z Zone.__iter__c C s t r| jj S | jj S d S )N)_py3r keysiterkeys)r r r r r. s z Zone.iterkeysc C s | j j S )N)r r- )r r r r r- s z Zone.keysc C s t r| jj S | jj S d S )N)r, r values itervalues)r r r r r0 s zZone.itervaluesc C s | j j S )N)r r/ )r r r r r/ s z Zone.valuesc C s | j j S )N)r items)r r r r r1 s z Zone.itemsc C s | j |}| jj|S )N)r% r get)r r& r r r r2 s zZone.getc C s || j kS )N)r )r r r r r __contains__ s zZone.__contains__Fc C s< | j |}| jj|}|dkr8|s&t| j }|| j|< |S )ar Find a node in the zone, possibly creating it. @param name: the name of the node to find @type name: dns.name.Name object or string @param create: should the node be created if it doesn't exist? @type create: bool @raises KeyError: the name is not known and create was not specified. @rtype: dns.node.Node object N)r% r r2 r# node_factory)r r createnoder r r find_node s zZone.find_nodec C s. y| j ||}W n tk r( d}Y nX |S )a Get a node in the zone, possibly creating it. This method is like L{find_node}, except it returns None instead of raising an exception if the node does not exist and creation has not been requested. @param name: the name of the node to find @type name: dns.name.Name object or string @param create: should the node be created if it doesn't exist? @type create: bool @rtype: dns.node.Node object or None N)r7 r# )r r r5 r6 r r r get_node s z Zone.get_nodec C s | j |}|| jkr | j|= dS )zhDelete the specified node if it exists. It is not an error if the node does not exist. N)r% r )r r r r r delete_node s zZone.delete_nodec C sT | j |}t|tr tjj|}t|tr6tjj|}| j||}|j| j|||S )a Look for rdata with the specified name and type in the zone, and return an rdataset encapsulating it. The I{name}, I{rdtype}, and I{covers} parameters may be strings, in which case they will be converted to their proper type. The rdataset returned is not a copy; changes to it will change the zone. KeyError is raised if the name or type are not found. Use L{get_rdataset} if you want to have None returned instead. @param name: the owner name to look for @type name: DNS.name.Name object or string @param rdtype: the rdata type desired @type rdtype: int or string @param covers: the covered type (defaults to None) @type covers: int or string @param create: should the node and rdataset be created if they do not exist? @type create: bool @raises KeyError: the node or rdata could not be found @rtype: dns.rrset.RRset object ) r% r r r rdatatyper r7 find_rdatasetr )r r rdtypecoversr5 r6 r r r r; s zZone.find_rdatasetc C s2 y| j ||||}W n tk r, d}Y nX |S )a Look for rdata with the specified name and type in the zone, and return an rdataset encapsulating it. The I{name}, I{rdtype}, and I{covers} parameters may be strings, in which case they will be converted to their proper type. The rdataset returned is not a copy; changes to it will change the zone. None is returned if the name or type are not found. Use L{find_rdataset} if you want to have KeyError raised instead. @param name: the owner name to look for @type name: DNS.name.Name object or string @param rdtype: the rdata type desired @type rdtype: int or string @param covers: the covered type (defaults to None) @type covers: int or string @param create: should the node and rdataset be created if they do not exist? @type create: bool @rtype: dns.rrset.RRset object N)r; r# )r r r< r= r5 rdatasetr r r get_rdataset s zZone.get_rdatasetc C sr | j |}t|tr tjj|}t|tr6tjj|}| j|}|dk rn|j| j|| t |dkrn| j | dS )a Delete the rdataset matching I{rdtype} and I{covers}, if it exists at the node specified by I{name}. The I{name}, I{rdtype}, and I{covers} parameters may be strings, in which case they will be converted to their proper type. It is not an error if the node does not exist, or if there is no matching rdataset at the node. If the node has no rdatasets after the deletion, it will itself be deleted. @param name: the owner name to look for @type name: DNS.name.Name object or string @param rdtype: the rdata type desired @type rdtype: int or string @param covers: the covered type (defaults to None) @type covers: int or string Nr ) r% r r r r: r r8 delete_rdatasetr lenr9 )r r r< r= r6 r r r r@ 4 s zZone.delete_rdatasetc C s. |j | j krtd| j|d}|j| dS )a: Replace an rdataset at name. It is not an error if there is no rdataset matching I{replacement}. Ownership of the I{replacement} object is transferred to the zone; in other words, this method does not store a copy of I{replacement} at the node, it stores I{replacement} itself. If the I{name} node does not exist, it is created. @param name: the owner name @type name: DNS.name.Name object or string @param replacement: the replacement rdataset @type replacement: dns.rdataset.Rdataset z#replacement.rdclass != zone.rdclassTN)r r r7 replace_rdataset)r r Z replacementr6 r r r rB U s zZone.replace_rdatasetc C sn | j |}t|tr tjj|}t|tr6tjj|}| j| j| j||}tj j || j||}|j | |S )a Look for rdata with the specified name and type in the zone, and return an RRset encapsulating it. The I{name}, I{rdtype}, and I{covers} parameters may be strings, in which case they will be converted to their proper type. This method is less efficient than the similar L{find_rdataset} because it creates an RRset instead of returning the matching rdataset. It may be more convenient for some uses since it returns an object which binds the owner name to the rdata. This method may not be used to create new nodes or rdatasets; use L{find_rdataset} instead. KeyError is raised if the name or type are not found. Use L{get_rrset} if you want to have None returned instead. @param name: the owner name to look for @type name: DNS.name.Name object or string @param rdtype: the rdata type desired @type rdtype: int or string @param covers: the covered type (defaults to None) @type covers: int or string @raises KeyError: the node or rdata could not be found @rtype: dns.rrset.RRset object ) r% r r r r: r r r; r rrsetZRRsetupdate)r r r< r= r> rC r r r find_rrsetk s zZone.find_rrsetc C s0 y| j |||}W n tk r* d}Y nX |S )aJ Look for rdata with the specified name and type in the zone, and return an RRset encapsulating it. The I{name}, I{rdtype}, and I{covers} parameters may be strings, in which case they will be converted to their proper type. This method is less efficient than the similar L{get_rdataset} because it creates an RRset instead of returning the matching rdataset. It may be more convenient for some uses since it returns an object which binds the owner name to the rdata. This method may not be used to create new nodes or rdatasets; use L{find_rdataset} instead. None is returned if the name or type are not found. Use L{find_rrset} if you want to have KeyError raised instead. @param name: the owner name to look for @type name: DNS.name.Name object or string @param rdtype: the rdata type desired @type rdtype: int or string @param covers: the covered type (defaults to None) @type covers: int or string @rtype: dns.rrset.RRset object N)rE r# )r r r< r= rC r r r get_rrset s zZone.get_rrsetc c s~ t |trtjj|}t |tr,tjj|}xL| j D ]@\}}x6|D ].}|tjjksh|j|krD|j|krD||fV qDW q6W dS )a Return a generator which yields (name, rdataset) tuples for all rdatasets in the zone which have the specified I{rdtype} and I{covers}. If I{rdtype} is dns.rdatatype.ANY, the default, then all rdatasets will be matched. @param rdtype: int or string @type rdtype: int or string @param covers: the covered type (defaults to None) @type covers: int or string N) r r r r: r iteritemsANYr< r= )r r< r= r r6 rdsr r r iterate_rdatasets s zZone.iterate_rdatasetsc c s t |trtjj|}t |tr,tjj|}x^| j D ]R\}}xH|D ]@}|tjjksh|j|krD|j|krDx|D ]}||j |fV qnW qDW q6W dS )a Return a generator which yields (name, ttl, rdata) tuples for all rdatas in the zone which have the specified I{rdtype} and I{covers}. If I{rdtype} is dns.rdatatype.ANY, the default, then all rdatas will be matched. @param rdtype: int or string @type rdtype: int or string @param covers: the covered type (defaults to None) @type covers: int or string N) r r r r: r rG rH r< r= ttl)r r< r= r r6 rI rdatar r r iterate_rdatas s zZone.iterate_rdatasNc C s8 t |trt|d}d}nd}t|dd}|dkr6d}|dkrPtjj|}d}n"t |trf|j|}n |}|j }z|rt| j }|j n| j }x|D ]} | | j | | j |d} t | tr| j|} n | } | j } y|j| |j| W q tk r |j| |j| Y qX qW W d|r2|j X dS ) a Write a zone to a file. @param f: file or string. If I{f} is a string, it is treated as the name of a file to open. @param sorted: if True, the file will be written with the names sorted in DNSSEC order from least to greatest. Otherwise the names will be written in whatever order they happen to have in the zone's dictionary. @param relativize: if True, domain names in the output will be relativized to the zone's origin (if possible). @type relativize: bool @param nl: The end of line string. If not specified, the output will use the platform's native end-of-line marker (i.e. LF on POSIX, CRLF on Windows, CR on Macintosh). @type nl: string or None wbTFencodingNzutf-8 )r r )r r opengetattroslinesepencodedecodelistr- sortr. to_textr r write TypeErrorclose) r fsortedr nl want_closeZfile_encZnl_bnamesnlZl_br r r to_file sD z Zone.to_filec C s* t }| j|||| |j }|j |S )a Return a zone's text as though it were written to a file. @param sorted: if True, the file will be written with the names sorted in DNSSEC order from least to greatest. Otherwise the names will be written in whatever order they happen to have in the zone's dictionary. @param relativize: if True, domain names in the output will be relativized to the zone's origin (if possible). @type relativize: bool @param nl: The end of line string. If not specified, the output will use the platform's native end-of-line marker (i.e. LF on POSIX, CRLF on Windows, CR on Macintosh). @type nl: string or None )r rd getvaluer\ )r r^ r r_ Z temp_bufferZ return_valuer r r rY $ s z Zone.to_textc C sJ | j rtjj}n| j}| j|tjjdkr.t| j|tjj dkrFt dS )zDo some simple checking of the zone's origin. @raises dns.zone.NoSOA: there is no SOA RR @raises dns.zone.NoNS: there is no NS RRset @raises KeyError: there is no origin node N) r r r emptyr r? r: ZSOAr ZNSr )r r r r r check_origin9 s zZone.check_origin)F)F)TTN)TTN),r r r r r r6 ZNoder4 __slots__ rdataclassINr r! r" r% r' r) r* r+ r. r- r0 r/ r1 rG r2 r3 r7 r8 r9 r: ZNONEr; r? r@ rB rE rF rH rJ rM rd rY rg r r r r r = sJ # !(" @ r c @ sH e Zd ZdZeddfddZdd Zdd Zd d Zd d Z dd Z dS ) _MasterReadera Read a DNS master file @ivar tok: The tokenizer @type tok: dns.tokenizer.Tokenizer object @ivar ttl: The default TTL @type ttl: int @ivar last_name: The last name read @type last_name: dns.name.Name object @ivar current_origin: The current origin @type current_origin: dns.name.Name object @ivar relativize: should names in the zone be relativized? @type relativize: bool @ivar zone: the zone @type zone: dns.zone.Zone object @ivar saved_state: saved reader state (used when processing $INCLUDE) @type saved_state: list of (tokenizer, current_origin, last_name, file) tuples. @ivar current_file: the file object of the $INCLUDed file being parsed (None if no $INCLUDE is active). @ivar allow_include: is $INCLUDE allowed? @type allow_include: bool @ivar check_origin: should sanity checks of the origin node be done? The default is True. @type check_origin: bool FTc C sb t |trtjj|}|| _|| _|| _d| _| j| _ ||||d| _ g | _ d | _ || _ || _d S )Nr )r )r r r r r tokcurrent_originr rK last_namezone saved_state current_file allow_includerg )r rl r r r zone_factoryrr rg r r r r f s z_MasterReader.__init__c C s x| j j }|j rP qW d S )N)rl r2 is_eol_or_eof)r tokenr r r _eat_lineu s z_MasterReader._eat_linec " C s | j dkrt| jjdd}|j s:tjj|j| j | _ n"| jj }|j rPdS | jj | | j }|j | j js|| j dS | jr|j| j j}| jj }|j stjjy,tjj|j}| jj }|j stjjW n tjjk r | j}Y nX y.tjj|j}| jj }|j s"tjjW n> tjjk rF tjjY n tk rb | j j}Y nX || j jkr~tjjdytjj|j}W n tjjd|j Y nX | j jj|}|dkr| j j }|| j j|< y tj j||| j| j d}W nl tjjk r, t j dd \}} | Y n< t j dd \}} tjjdt |t | f Y nX |j | j j| j |j! } |j"||| d} | j#|| dS ) z(Process one line from a DNS master file.NT)Z want_leadingz RR class is not zone's classzunknown rdatatype '%s'F zcaught exception %s: %s)$rm r rl r2 Z is_whitespacer r r r( rn rt ungetr$ ro r rv r is_identifier exception SyntaxErrorrK BadTTLri Exceptionr r: r r4 rL sysexc_infostrchoose_relativityr= r; add) r ru r rK r r< rb rdtyvar= rI r r r _rr_line{ sx z_MasterReader._rr_linec C s t jd}t jd}t jd}|j|}|rJ|j \}}}} } |dkrJd}|j|} | rz| j \}}}|dkrrd}d} d} |j|} | r|j \}}}} |dkrd}|j d } d} |p| p| sd}d}d}d} d} | dkrt |||| | fS ) Nz"^.*\$({(\+|-?)(\d+),(\d+),(.)}).*$z^.*\$({(\+|-?)(\d+)}).*$z ^.*\$({(\+|-?)(\d+),(\d+)}).*$ +r drw )recompilematchgroupsNotImplementedError) r ZsideZ is_generate1Z is_generate2Z is_generate3Zg1modZsignoffsetwidthbaseZg2Zg3r r r _parse_modify s> z_MasterReader._parse_modifyc ! 7 C s | j dkrt| jj }y2tjj|j\}}}| jj }|j sHtj j W n tj j Y nX y$|j}| jj }|j stj j W n tj j Y nX y,tj j|j}| jj }|j stj j W n tj j k r | j }Y nX y.tj j|j}| jj }|j stj j W n> tj j k r6 tj j Y n tk rR | jj}Y nX || jjkrntj j dy.tjj|j}| jj }|j stj j W n( tk r tj j d|j Y nX y |j} W n tj j Y nX | j|\} } } } }| j| \}}}}}xt||d |D ]}| dkr@|t| }n| dkrV|t| }|dkrn|t| }n|dkr|t| }t|jt| }t|jt|}|jd| |}| jd| |}tjj|| j | _| j}|j| jjs| j dS | j r|j | jj}| jj j|}|dkr@| jj }|| jj |< ytj j|||| j d} W nl tj j k r t!j" dd \} } | Y n< t!j" dd \} } tj j d t| t| f Y nX | j#| jj| j | j$ } |j%||| d } | j&| | q"W dS ) zRProcess one line containing the GENERATE statement from a DNS master file.Nz RR class is not zone's classzunknown rdatatype '%s'r r -z$%sFrw zcaught exception %s: %sT)'rm r rl r2 r Zgranger r( ry rz r{ rK r| ri r} ro r r: r rangeintr zfillreplacer rn r$ r rv r r r4 rL r~ r r r= r; r )!r ru startstopstepZlhsrK r r< ZrhsZlmodZlsignZloffsetZlwidthZlbaseZrmodZrsignZroffsetZrwidthZrbaseiZlindexrindexZlzfindexZrzfindexr rL rb r r r r= rI r r r _generate_line s z _MasterReader._generate_linec C s y x| j jdd}|j rh| jdk r2| jj t| jdkrb| jjd\| _ | _| _ | _| _ qP n|j rvqn|j r| j j qnx|jd dkr|jj }|dkr| j j }|j stjjdtj j|j| _ | j j q|dkr$| j j | _| j j | jjdkr| j| j_q|d kr| jr| j j }|j}| j j }|j rxtjj|j| j}| j j n |j stjjd n| j}| jj| j | j| j | j| j f t |d | _tj j | j|| _ || _q|d kr| j qtjjd | d q| j j | | j! qW W nZ tjjk rz } z8| j j" \}}|dkrTd}tjjd|||f W Y dd}~X nX | j#r| jj# dS )zRead a DNS master file and build a zone object. @raises dns.zone.NoSOA: No SOA RR was found at the zone origin @raises dns.zone.NoNS: No NS RRset was found at the zone origin TNr r $z$TTLzbad $TTLz$ORIGINz$INCLUDEzbad origin in $INCLUDErz $GENERATEz Unknown master file directive ''z syntax errorz %s:%d: %s)$rl r2 Zis_eofrq r\ rA rp poprm rn rK Zis_eolZ is_commentZget_eolr( upperry r rz r{ r Zget_namero r rr r rt appendrQ tokenizer Tokenizerr rx r whererg )r ru cfilenameZ new_originZdetailZ line_numberr r r reade s "z_MasterReader.readN) r r r r r r rv r r r r r r r r rk J s L)urk TFc C s> |dkr d}t jj| |}t|||||||d} | j | jS )ar Build a zone object from a master file format string. @param text: the master file format input @type text: string. @param origin: The origin of the zone; if not specified, the first $ORIGIN statement in the master file will determine the origin of the zone. @type origin: dns.name.Name object or string @param rdclass: The zone's rdata class; the default is class IN. @type rdclass: int @param relativize: should names be relativized? The default is True @type relativize: bool @param zone_factory: The zone factory to use @type zone_factory: function returning a Zone @param filename: The filename to emit when describing where an error occurred; the default is '<string>'. @type filename: string @param allow_include: is $INCLUDE allowed? @type allow_include: bool @param check_origin: should sanity checks of the origin node be done? The default is True. @type check_origin: bool @raises dns.zone.NoSOA: No SOA RR was found at the zone origin @raises dns.zone.NoNS: No NS RRset was found at the zone origin @rtype: dns.zone.Zone object Nz<string>)rr rg )r r r rk r ro ) textr r r rs r rr rg rl readerr r r r s " r c C sl t }d} t| |r.|dkr | }t| | } d} n|dkr:d}d} zt| |||||||} W d| rf| j X | S )a Read a master file and build a zone object. @param f: file or string. If I{f} is a string, it is treated as the name of a file to open. @param origin: The origin of the zone; if not specified, the first $ORIGIN statement in the master file will determine the origin of the zone. @type origin: dns.name.Name object or string @param rdclass: The zone's rdata class; the default is class IN. @type rdclass: int @param relativize: should names be relativized? The default is True @type relativize: bool @param zone_factory: The zone factory to use @type zone_factory: function returning a Zone @param filename: The filename to emit when describing where an error occurred; the default is '<file>', or the value of I{f} if I{f} is a string. @type filename: string @param allow_include: is $INCLUDE allowed? @type allow_include: bool @param check_origin: should sanity checks of the origin node be done? The default is True. @type check_origin: bool @raises dns.zone.NoSOA: No SOA RR was found at the zone origin @raises dns.zone.NoNS: No NS RRset was found at the zone origin @rtype: dns.zone.Zone object ZrUNTz<file>F)r r rQ r r\ ) r] r r r rs r rr rg Zstr_typeZoptsr` zr r r from_file s r c C s d}x| D ]}|dkrH|r"|j }n |jd j}|jd j}||||d}x||jD ]r}|jj|j} | sz|j } | |j|j< | j|j|j|j d} | j |j x$|D ] } | j |j | | j | qW qPW q W |r|j |S )a Convert the output of a zone transfer generator into a zone object. @param xfr: The xfr generator @type xfr: generator of dns.message.Message objects @param relativize: should names be relativized? The default is True. It is essential that the relativize setting matches the one specified to dns.query.xfr(). @type relativize: bool @param check_origin: should sanity checks of the origin node be done? The default is True. @type check_origin: bool @raises dns.zone.NoSOA: No SOA RR was found at the zone origin @raises dns.zone.NoNS: No NS RRset was found at the zone origin @rtype: dns.zone.Zone object Nr )r T)r Zanswerr r r r2 r4 r; r< r= Z update_ttlrK r r rg ) Zxfrrs r rg r r r r rC ZznodeZzrdsr r r r from_xfr s, r )r )&r Z __future__r r~ r rS ior Z dns.exceptionr Zdns.nameZdns.nodeZdns.rdataclassZ dns.rdatatypeZ dns.rdataZ dns.rrsetZ dns.tokenizerZdns.ttlZ dns.grangeZ_compatr r version_infor, rz Z DNSExceptionr r r r objectr rk ri rj r r r r r r r <module> sH o*3PK g\f5 ( __pycache__/entropy.cpython-36.opt-1.pycnu [ 3 bWq @ s d dl Z d dlZd dlZddlmZmZ y d dlZW n ek rP d dl ZY nX G dd de Z e Z y ej ZW n ek r dZY nX dd Zdd ZdS ) N )long binary_typec @ sH e Zd ZdddZdddZdd Zd d Zd d Zd d Zdd Z dS ) EntropyPoolNc C s d| _ d | _d| _tj | _y dd l}|j | _d| _ W n^ t k r y dd l }|j | _d| _ W n, t k r dd l }|j | _d| _ Y nX Y nX td| j | _|d k r| jt| d| _tj | _n d| _d| _d S )Nr TF) pool_indexdigest next_byte _threadingZLocklockhashlibZsha1hashhash_len ImportErrorshanewmd5 bytearraypoolstirseededosgetpidseed_pid)selfseedr r r r /usr/lib/python3.6/entropy.py__init__ s0 zEntropyPool.__init__Fc C sr |s| j j zNxH|D ]@}| j| jkr,d| _|d@ }| j| j |N < | jd7 _qW W d |sl| j j X d S )Nr r )r acquirer r r release)r ZentropyZalready_lockedcbr r r r 7 s zEntropyPool.stirc C s | j s| jtj krytjd}W n` tk r y*tddd}z|jd}W d |j X W n tk r~ t t j }Y nX Y nX d| _ tj | _d | _ t |}| j |d d S )Nr z /dev/urandomrbr T)r r r r urandom Exceptionopenreadclosestrtimer r r )r r rr r r _maybe_seedE s zEntropyPool._maybe_seedc C s | j j zr| j | jd ks*| j| jkr`| jjt| j t | jj | _| j | jd d| _| j| j }| jd7 _W d | j j X |S )NTr r ) r r" r/ r r r r updater r r r r# )r valuer r r random_8X s zEntropyPool.random_8c C s | j d | j S )N )r2 )r r r r random_16g s zEntropyPool.random_16c C s | j d | j S )Ni )r4 )r r r r random_32j s zEntropyPool.random_32c C sl || d }|t dkr td|dkr8| j}t d}n |dkrL| j}d}n | j}d}||| |d S ) Nr l ztoo bigi l r3 i r! )r ValueErrorr5 r4 r2 )r firstlastsizeZrandmaxr r r random_betweenm s zEntropyPool.random_between)N)F) __name__ __module__ __qualname__r r r/ r2 r4 r5 r; r r r r r s r c C s t d k rt jddS tj S d S )Nr i ) system_random randranger r4 r r r r r4 s r4 c C s( t d k rt j| |d S tj| |S d S )Nr )r? r@ r r; )r7 r8 r r r between s rA )r Zrandomr- Z_compatr r Z threadingr r Zdummy_threadingobjectr r Z SystemRandomr? r( r4 rA r r r r <module> s b PK g\: & __pycache__/rcode.cpython-36.opt-1.pycnu [ 3 bW @ s d Z ddlZddlmZ dZdZdZdZdZ dZ d Z d Z d Z d Zd ZdZeeeee e e e e eeed Zedd ej D ZG dd dejjZdd Zdd Zdd Zdd ZdS ) zDNS Result Codes. N )long ) NOERRORFORMERRSERVFAILNXDOMAINNOTIMPREFUSEDYXDOMAINYXRRSETNXRRSETNOTAUTHNOTZONEBADVERSc c s | ]\}}||fV qd S )N ).0xyr r /usr/lib/python3.6/rcode.py <genexpr>6 s r c @ s e Zd ZdZdS ) UnknownRcodezA DNS rcode is unknown.N)__name__ __module__ __qualname____doc__r r r r r 9 s r c C sB | j r$t| }|dkr$|dkr$|S tj| j }|dkr>t|S )zConvert text into an rcode. @param text: the textual rcode @type text: string @raises UnknownRcode: the rcode is unknown @rtype: int r i N)isdigitint_by_textgetupperr )textvr r r from_text> s r, c C s0 | d@ |d? d@ B }|dk s$|dkr,t d|S )zReturn the rcode value encoded by flags and ednsflags. @param flags: the DNS flags @type flags: int @param ednsflags: the EDNS flags @type ednsflags: int @raises ValueError: rcode is < 0 or > 4095 @rtype: int i r i z rcode must be >= 0 and <= 4095) ValueError)flagsZ ednsflagsvaluer r r from_flagsQ s r2 c C s8 | dk s| dkrt d| d@ }t| d@ d> }||fS )zReturn a (flags, ednsflags) tuple which encodes the rcode. @param value: the rcode @type value: int @raises ValueError: rcode is < 0 or > 4095 @rtype: (int, int) tuple r i z rcode must be >= 0 and <= 4095r- i r. )r/ r )r1 r+ Zevr r r to_flagsb s r3 c C s t j| }|dkrt| }|S )zbConvert rcode into text. @param value: the rcode @type value: int @rtype: string N) _by_valuer( str)r1 r* r r r to_textr s r6 ) r$ Z dns.exceptionZdnsZ_compatr r r r r r r r r r r r r r' dictitemsr4 Z exceptionZ DNSExceptionr r, r2 r3 r6 r r r r <module> s@ PK g\雅Xc& c& # __pycache__/renderer.cpython-36.pycnu [ 3 bW. @ sh d Z ddlmZ ddlZddlZddlZddlZddlZddl m Z dZ dZ dZ dZG dd d eZdS ) z*Help for building DNS wire format messages )BytesION )long c @ st e Zd ZdZdddZdd Zd d Zejj fd d Z d d Z dd Z dddZ ejjfddZdd Zdd ZdS )Rendererai Helper class for building DNS wire-format messages. Most applications can use the higher-level L{dns.message.Message} class and its to_wire() method to generate wire-format messages. This class is for those applications which need finer control over the generation of messages. Typical use:: r = dns.renderer.Renderer(id=1, flags=0x80, max_size=512) r.add_question(qname, qtype, qclass) r.add_rrset(dns.renderer.ANSWER, rrset_1) r.add_rrset(dns.renderer.ANSWER, rrset_2) r.add_rrset(dns.renderer.AUTHORITY, ns_rrset) r.add_edns(0, 0, 4096) r.add_rrset(dns.renderer.ADDTIONAL, ad_rrset_1) r.add_rrset(dns.renderer.ADDTIONAL, ad_rrset_2) r.write_header() r.add_tsig(keyname, secret, 300, 1, 0, '', request_mac) wire = r.get_wire() @ivar output: where rendering is written @type output: BytesIO object @ivar id: the message id @type id: int @ivar flags: the message flags @type flags: int @ivar max_size: the maximum size of the message @type max_size: int @ivar origin: the origin to use when rendering relative names @type origin: dns.name.Name object @ivar compress: the compression table @type compress: dict @ivar section: the section currently being rendered @type section: int (dns.renderer.QUESTION, dns.renderer.ANSWER, dns.renderer.AUTHORITY, or dns.renderer.ADDITIONAL) @ivar counts: list of the number of RRs in each section @type counts: int list of length 4 @ivar mac: the MAC of the rendered message (if TSIG was used) @type mac: string Nr c C sh t | _|dkr tjdd| _n|| _|| _|| _|| _i | _t | _ ddddg| _ | jj d d| _ dS )a Initialize a new renderer. @param id: the message id @type id: int @param flags: the DNS message flags @type flags: int @param max_size: the maximum message size; the default is 65535. If rendering results in a message greater than I{max_size}, then L{dns.exception.TooBig} will be raised. @type max_size: int @param origin: the origin to use when rendering relative names @type origin: dns.name.Name or None. Nr i s )r outputrandomZrandintidflagsmax_sizeorigincompressQUESTIONsectioncountswritemac)selfr r r r r /usr/lib/python3.6/renderer.py__init__N s zRenderer.__init__c C s^ | j j| | j j g }x(| jj D ]\}}||kr&|j| q&W x|D ] }| j|= qJW dS )zTruncate the output buffer at offset I{where}, and remove any compression table entries that pointed beyond the truncation point. @param where: the offset @type where: int N)r seektruncater itemsappend)r whereZkeys_to_deletekvr r r _rollbackk s zRenderer._rollbackc C s& | j |kr"| j |kr tjj|| _ dS )aZ Set the renderer's current section. Sections must be rendered order: QUESTION, ANSWER, AUTHORITY, ADDITIONAL. Sections may be empty. @param section: the section @type section: int @raises dns.exception.FormError: an attempt was made to set a section value less than the current section. N)r dns exceptionZ FormError)r r r r r _set_section} s zRenderer._set_sectionc C sz | j t | jj }|j| j| j| j | jjtj d|| | jj }|| j krd| j | t j j| jt d7 < dS )a Add a question to the message. @param qname: the question name @type qname: dns.name.Name @param rdtype: the question rdata type @type rdtype: int @param rdclass: the question rdata class @type rdclass: int z!HHr N)r& r r tellto_wirer r r structpackr r# r$ r% TooBigr )r ZqnameZrdtypeZrdclassbeforeafterr r r add_question s zRenderer.add_questionc K sh | j | | jj }|j| j| j| jf|}| jj }|| jkrR| j| tj j | j | |7 < dS )a Add the rrset to the specified section. Any keyword arguments are passed on to the rdataset's to_wire() routine. @param section: the section @type section: int @param rrset: the rrset @type rrset: dns.rrset.RRset object N) r& r r' r( r r r r# r$ r% r+ r )r r Zrrsetkwr, nr- r r r add_rrset s zRenderer.add_rrsetc K sj | j | | jj }|j|| j| j| jf|}| jj }|| jkrT| j| tj j | j | |7 < dS )a Add the rdataset to the specified section, using the specified name as the owner name. Any keyword arguments are passed on to the rdataset's to_wire() routine. @param section: the section @type section: int @param name: the owner name @type name: dns.name.Name object @param rdataset: the rdataset @type rdataset: dns.rdataset.Rdataset object N) r& r r' r( r r r r# r$ r% r+ r )r r nameZrdatasetr/ r, r0 r- r r r add_rdataset s zRenderer.add_rdatasetc C s |t dM }||d> O }| jt | jj }| jjtjddtj j ||d |dk rJ| jj }x|D ]}tjd|j d}| jj| | jj } |j | j | jj } | | dk st | jj| d tjd | | }| jj| | jjdd qfW | jj } | | dk st | jj|d tjd | | }| jj| | jjdd | jj } | | jkrr| j| tjj| jt d 7 < dS ) a Add an EDNS OPT record to the message. @param edns: The EDNS level to use. @type edns: int @param ednsflags: EDNS flag values. @type ednsflags: int @param payload: The EDNS sender's payload field, which is the maximum size of UDP datagram the sender can handle. @type payload: int @param options: The EDNS options list @type options: list of dns.edns.Option instances @see: RFC 2671 l ~ z!BHHIHr Nz!HHi r z!Hr )r r& ADDITIONALr r' r r) r* r$ rdatatypeOPTZotyper( AssertionErrorr r r# r% r+ r ) r ZednsZ ednsflagsZpayloadZoptionsr, ZlstartoptZstuffstartendZlendr- r r r add_edns s< zRenderer.add_ednsc C sB | j t | jj } | jj } tjj| ||tt j ||||||d \} | _ } |j | j| j | j | jjtjdtjjtjjdd | jj } | jj| | jj }|| dk st|| jkr| j| tjj| jj| d | jjtjd|| | jt d7 < | jjd | jjtjd| jt | jjdd d S ) a Add a TSIG signature to the message. @param keyname: the TSIG key name @type keyname: dns.name.Name object @param secret: the secret to use @type secret: string @param fudge: TSIG time fudge @type fudge: int @param id: the message id to encode in the tsig signature @type id: int @param tsig_error: TSIG error code; default is 0. @type tsig_error: int @param other_data: TSIG other data. @type other_data: string @param request_mac: This message is a response to the request which had the specified MAC. @type request_mac: string @param algorithm: the TSIG algorithm to use @type algorithm: dns.name.Name object ) algorithmz!HHIHr i r z!Hr N) r& r5 r r' getvaluer$ tsigZsigninttimer r( r r r r) r* r6 ZTSIG rdataclassANYr8 r r# r% r+ r r )r ZkeynameZsecretZfudger Z tsig_errorZ other_dataZ request_macr= r, sZ tsig_rdataZctxZ rdata_startr- r r r add_tsig s: zRenderer.add_tsigc C sX | j jd | j jtjd| j| j| jd | jd | jd | jd | j jdd dS )zWrite the DNS message header. Writing the DNS message header is done after all sections have been rendered, but before the optional TSIG signature is added. r z!HHHHHHr r r N)r r r r) r* r r r )r r r r write_header5 s zRenderer.write_headerc C s | j j S )z@Return the wire format message. @rtype: string )r r? )r r r r get_wireC s zRenderer.get_wire)Nr r N)N)__name__ __module__ __qualname____doc__r r# r& r$ rC INr. r1 r3 r< r@ Zdefault_algorithmrF rG rH r r r r r " s * 04r )rL ior r) r rB Z dns.exceptionr$ Zdns.tsigZ_compatr r ZANSWERZ AUTHORITYr5 objectr r r r r <module> s PK g\YZ 8 8 & __pycache__/rdata.cpython-36.opt-1.pycnu [ 3 bW: @ s d Z ddlmZ ddlZddlZddlZddlZddlZddl Zddl Zddl Zddl m Z mZmZ dZefddZdZefd d Zed Zd d Zdd ZG dd deZG dd deZi ZdZ dd Z d ddZ d ddZ dS ) a DNS rdata. @var _rdata_modules: A dictionary mapping a (rdclass, rdtype) tuple to the module which implements that type. @type _rdata_modules: dict @var _module_prefix: The prefix to use when forming modules names. The default is 'dns.rdtypes'. Changing this value will break the library. @type _module_prefix: string @var _hex_chunk: At most this many octets that will be represented in each chunk of hexstring that _hexify() produces before whitespace occurs. @type _hex_chunk: int )BytesION )xrange string_types text_type c s4 t j| dj fddtdt D j S )a Convert a binary string into its hex encoding, broken up into chunks of I{chunksize} characters separated by a space. @param data: the binary string @type data: string @param chunksize: the chunk size. Default is L{dns.rdata._hex_chunksize} @rtype: string c s g | ]}|| qS r ).0i) chunksizeliner /usr/lib/python3.6/rdata.py <listcomp>6 s z_hexify.<locals>.<listcomp>r )binasciiZhexlifyjoinrangelendecode)datar r )r r r _hexify+ s r c s4 t j| dj fddtdt D j S )a$ Convert a binary string into its base64 encoding, broken up into chunks of I{chunksize} characters separated by a space. @param data: the binary string @type data: string @param chunksize: the chunk size. Default is L{dns.rdata._base64_chunksize} @rtype: string r c s g | ]}|| qS r r )r r )r r r r r I s z _base64ify.<locals>.<listcomp>r )base64Z b64encoder r r r )r r r )r r r _base64ify= s r s "\c C s~ t | tr| j } t | ts$t| } d}xP| D ]H}|tkrL|dt| 7 }q.|dkrj|dk rj|t|7 }q.|d| 7 }q.W |S )zEscape the characters in a quoted string which need it. @param qstring: the string @type qstring: string @returns: the escaped string @rtype: string \r z\%03d) isinstancer encode bytearray __escapedchr)Zqstringtextcr r r _escapifyO s r# c C sF x8t t| d ddD ] }| | dkr| d|d S qW | dd S )zDetermine the index of greatest byte that isn't all zeros, and return the bitmap that contains all the bytes less than that index. @param what: a string of octets representing a bitmap. @type what: string @rtype: string r r r$ )r r )Zwhatr r r r _truncate_bitmaph s r% c @ s e Zd ZdZddgZdd Zdd Zdd Zd.d d Zd/ddZ d0ddZ dd Z dd Z dd Z dd Zdd Zd d Zd d Zd d! Zd"d# Zd$d% Zd&d' Zed1d(d)Zed2d*d+Zd3d,d-Zd S )4Rdataz(Base class for all DNS rdata types. rdclassrdtypec C s || _ || _dS )zInitialize an rdata. @param rdclass: The rdata class @type rdclass: int @param rdtype: The rdata type @type rdtype: int N)r' r( )selfr' r( r r r __init__~ s zRdata.__init__c C s t jjS )a_ DNS SIG/RRSIG rdatas apply to a specific type; this type is returned by the covers() function. If the rdata type is not SIG or RRSIG, dns.rdatatype.NONE is returned. This is useful when creating rdatasets, allowing the rdataset to contain only RRSIGs of a particular type, e.g. RRSIG(NS). @rtype: int )dns rdatatypeNONE)r) r r r covers s z Rdata.coversc C s | j d> | jB S )zReturn a 32-bit type value, the least significant 16 bits of which are the ordinary DNS type, and the upper 16 bits of which are the "covered" type, if any. @rtype: int )r. r( )r) r r r extended_rdatatype s zRdata.extended_rdatatypeNTc K s t dS )z@Convert an rdata to text format. @rtype: string N)NotImplementedError)r) origin relativizekwr r r to_text s z Rdata.to_textc C s t dS )z@Convert an rdata to wire format. @rtype: string N)r1 )r) filecompressr2 r r r to_wire s z Rdata.to_wirec C s t }| j|d| |j S )zlConvert rdata to a format suitable for digesting in hashes. This is also the DNSSEC canonical form.N)r r8 getvalue)r) r2 fr r r to_digestable s zRdata.to_digestablec C s t jj| j| j| j dS )zCheck that the current contents of the rdata's fields are valid. If you change an rdata by assigning to its fields, it is a good idea to call validate() when you are done making changes. N)r+ rdata from_textr' r( r5 )r) r r r validate s zRdata.validatec C sf | j }|tjjkrd}ndtjj| d }dtjj| j d tjj| j | d t| d S )Nr ()z<DNS z rdata: >) r. r+ r, r- r5 rdataclassr' r( str)r) r. Zctextr r r __repr__ s zRdata.__repr__c C s | j S )N)r5 )r) r r r __str__ s z Rdata.__str__c C s8 | j tjj}|j tjj}||kr(dS ||kr4dS dS )zCompare an rdata with another rdata of the same rdtype and rdclass. Return < 0 if self < other in the DNSSEC ordering, 0 if self == other, and > 0 if self > other. r r r$ )r; r+ nameroot)r) otherZourZtheirr r r _cmp s z Rdata._cmpc C s8 t |tsdS | j|jks&| j|jkr*dS | j|dkS )NFr )r r& r' r( rJ )r) rI r r r __eq__ s z Rdata.__eq__c C s8 t |tsdS | j|jks&| j|jkr*dS | j|dkS )NTr )r r& r' r( rJ )r) rI r r r __ne__ s z Rdata.__ne__c C s6 t |t s$| j|jks$| j|jkr(tS | j|dk S )Nr )r r& r' r( NotImplementedrJ )r) rI r r r __lt__ s z Rdata.__lt__c C s6 t |t s$| j|jks$| j|jkr(tS | j|dkS )Nr )r r& r' r( rM rJ )r) rI r r r __le__ s z Rdata.__le__c C s6 t |t s$| j|jks$| j|jkr(tS | j|dkS )Nr )r r& r' r( rM rJ )r) rI r r r __ge__ s z Rdata.__ge__c C s6 t |t s$| j|jks$| j|jkr(tS | j|dkS )Nr )r r& r' r( rM rJ )r) rI r r r __gt__ s z Rdata.__gt__c C s t | jtjjS )N)hashr; r+ rG rH )r) r r r __hash__ s zRdata.__hash__c C s t dS )a Build an rdata object from text format. @param rdclass: The rdata class @type rdclass: int @param rdtype: The rdata type @type rdtype: int @param tok: The tokenizer @type tok: dns.tokenizer.Tokenizer @param origin: The origin to use for relative names @type origin: dns.name.Name @param relativize: should names be relativized? @type relativize: bool @rtype: dns.rdata.Rdata instance N)r1 )clsr' r( tokr2 r3 r r r r= s zRdata.from_textc C s t dS )a< Build an rdata object from wire format @param rdclass: The rdata class @type rdclass: int @param rdtype: The rdata type @type rdtype: int @param wire: The wire-format message @type wire: string @param current: The offset in wire of the beginning of the rdata. @type current: int @param rdlen: The length of the wire-format rdata @type rdlen: int @param origin: The origin to use for relative names @type origin: dns.name.Name @rtype: dns.rdata.Rdata instance N)r1 )rT r' r( wirecurrentrdlenr2 r r r from_wire s zRdata.from_wirec C s dS )zWConvert any domain names in the rdata to the specified relativization. Nr )r) r2 r3 r r r choose_relativity& s zRdata.choose_relativity)NT)NN)N)NT)N)NT)__name__ __module__ __qualname____doc__ __slots__r* r. r0 r5 r8 r; r> rE rF rJ rK rL rN rO rP rQ rS classmethodr= rY rZ r r r r r& w s0 r& c sV e Zd ZdZdgZ fddZdddZedd d Zdd d Z edd dZ Z S ) GenericRdatazGenerate Rdata Class This class is used for rdata types for which we have no better implementation. It implements the DNS "unknown RRs" scheme. r c s t t| j|| || _d S )N)superra r* r )r) r' r( r ) __class__r r r* 8 s zGenericRdata.__init__NTc K s dt | j t| j S )Nz\# %d )r r r )r) r2 r3 r4 r r r r5 < s zGenericRdata.to_textc C s |j }|j s |jdkr(tjjd|j }g }x&|j }|j rHP |j|jj q6W dj |} t j | } t | |krtjjd| ||| S )Nz\#z$generic rdata does not start with \# z'generic rdata hex data has wrong length)get is_identifiervaluer+ Z exception SyntaxErrorZget_intZ is_eol_or_eofappendr r r Z unhexlifyr ) rT r' r( rU r2 r3 tokenZlengthZchunkshexr r r r r= ? s" zGenericRdata.from_textc C s |j | j d S )N)writer )r) r6 r7 r2 r r r r8 S s zGenericRdata.to_wirec C s | |||||| S )Nr )rT r' r( rV rW rX r2 r r r rY V s zGenericRdata.from_wire)NT)NT)NN)N) r[ r\ r] r^ r_ r* r5 r` r= r8 rY __classcell__r r )rc r ra . s ra z dns.rdtypesc C s dd }t j| |f}tjj| }tjj|}|jdd}|st jtjj|f}|sy$|djt ||g}|t | |f< W nV t k r y(|djt d|g}|t tjj|f< W n t k r d }Y nX Y nX |rt ||}nt }|S )Nc S s6 t | }| jd}x |dd D ]}t||}q W |S )N.r ) __import__splitgetattr)rG modZ componentscompr r r import_module` s z&get_rdata_class.<locals>.import_module-_rn ANY) _rdata_modulesre r+ rC r5 r, replacerw r _module_prefix ImportErrorrq ra )r' r( rt rr Z rdclass_textZ rdtype_textrT r r r get_rdata_class^ s. r| Tc C s t |trtjj|}t| |}|tkrx|j }|j| |j rx|j dkrxtj | ||||}t | ||j dt|j |S |j | ||||S )ad Build an rdata object from text format. This function attempts to dynamically load a class which implements the specified rdata class and type. If there is no class-and-type-specific implementation, the GenericRdata class is used. Once a class is chosen, its from_text() class method is called with the parameters to this function. If I{tok} is a string, then a tokenizer is created and the string is used as its input. @param rdclass: The rdata class @type rdclass: int @param rdtype: The rdata type @type rdtype: int @param tok: The tokenizer or input text @type tok: dns.tokenizer.Tokenizer or string @param origin: The origin to use for relative names @type origin: dns.name.Name @param relativize: Should names be relativized? @type relativize: bool @rtype: dns.rdata.Rdata instancez\#r )r r r+ Z tokenizer Tokenizerr| ra re Zungetrf rg r= rY r r )r' r( rU r2 r3 rT rj r< r r r r= s r= c C s* t jj|}t| |}|j| |||||S )a> Build an rdata object from wire format This function attempts to dynamically load a class which implements the specified rdata class and type. If there is no class-and-type-specific implementation, the GenericRdata class is used. Once a class is chosen, its from_wire() class method is called with the parameters to this function. @param rdclass: The rdata class @type rdclass: int @param rdtype: The rdata type @type rdtype: int @param wire: The wire-format message @type wire: string @param current: The offset in wire of the beginning of the rdata. @type current: int @param rdlen: The length of the wire-format rdata @type rdlen: int @param origin: The origin to use for relative names @type origin: dns.name.Name @rtype: dns.rdata.Rdata instance)r+ ZwiredataZ maybe_wrapr| rY )r' r( rV rW rX r2 rT r r r rY s rY )NT)N) r^ ior r r Z dns.exceptionr+ Zdns.nameZdns.rdataclassZ dns.rdatatypeZ dns.tokenizerZ dns.wiredataZ_compatr r r Z_hex_chunksizer Z_base64_chunksizer r r r# r% objectr& ra rx rz r| r= rY r r r r <module> s2 8," /PK g\o o ) __pycache__/wiredata.cpython-36.opt-1.pycnu [ 3 bW @ s^ d Z ddlZddlZddlmZmZ G dd deZe dd ZG dd deZ d d Z dS ) zDNS Wire Data Helper N ) binary_type string_typesc @ s& e Zd Zdd Zejdk r"dd ZdS )_SliceUnspecifiedBoundc C s |j S )N)stop)selfkey r /usr/lib/python3.6/wiredata.py __getitem__ s z"_SliceUnspecifiedBound.__getitem__ c C s | j t||S )N)r slice)r ijr r r __getslice__$ s z#_SliceUnspecifiedBound.__getslice__N)r )__name__ __module__ __qualname__r sys version_infor r r r r r s r c s> e Zd Z fddZejd k r&dd Zdd Zdd Z Z S ) WireDatac s yt |tr|j}|j}tjdk rx|tkr2t| }|dk sB|dk rJtj j ||krt t | j | t t | j |d n6x4||fD ](}|d krqqt|t| krtj j qW t t t | j t||S t| j | S tk r tj j Y nX d S )Nr r r )r ) isinstancer startr r r _unspecified_boundlendns exception FormErrorsuperr r abs bytearrayunwrap IndexError)r r r r index) __class__r r r - s, zWireData.__getitem__r c C s | j t||S )N)r r )r r r r r r r P s zWireData.__getslice__c c sB d}x8y| | V |d7 }W q t jjk r8 tY qX qW d S )Nr r )r r r StopIteration)r r r r r __iter__S s zWireData.__iter__c C s t | S )N)r )r r r r r! \ s zWireData.unwrap)r ) r r r r r r r r& r! __classcell__r r )r$ r r * s " r c C sJ t | tr| S t | tr t| S t | tr6t| j S tdt| d S )Nzunhandled type %s)r r r r encode ValueErrortype)Zwirer r r maybe_wrap` s r+ ) __doc__r Z dns.exceptionr Z_compatr r r r r r+ r r r r <module> s 6PK g\= ( __pycache__/version.cpython-36.opt-1.pycnu [ 3 bW @ s d Z dZdZdZdZdZedkr0deeef Zn,edkrJdeeeef Zndeeeeef Zed> ed> B ed > B ed > B eB Zd S ) z&dnspython release version information. z%d.%d.%dz %d.%d.%dx%dz %d.%d.%d%x%d N)__doc__ZMAJORZMINORZMICROZ RELEASELEVELZSERIALversion hexversion r r /usr/lib/python3.6/version.py<module> s PK g\_DBI I # __pycache__/__init__.cpython-36.pycnu [ 3 bW/ # @ sR d Z ddddddddd d d d d ddddddddddddddd d d d d d!d"d#g#Zd$S )%zdnspython DNS toolkitZdnssecZe164ZednsZentropyZ exceptionflagshashZinetZipv4Zipv6messagenameZnamedictZnodeZopcodeZqueryZrcodeZrdataZ rdataclassZrdatasetZ rdatatypeZrendererZresolverZ reversenameZrrsetsetZ tokenizerZtsigZ tsigkeyringZttlZrdtypesupdateversionZwiredataZzoneN)__doc____all__ r r /usr/lib/python3.6/__init__.py<module> sF PK g\M( ( __pycache__/ttl.cpython-36.pycnu [ 3 bW @ s8 d Z ddlZddlmZ G dd dejjZdd ZdS ) zDNS TTL conversion. N )longc @ s e Zd ZdZdS )BadTTLz!DNS TTL value is not well-formed.N)__name__ __module__ __qualname____doc__ r r /usr/lib/python3.6/ttl.pyr s r c C s* | j rt| }n| d j s"ttd}td}x| D ]}|j rZ|d9 }|t|7 }q8|j }|dkr|||td 7 }nl|dkr||td 7 }nR|dkr||td 7 }n8|d kr||td 7 }n |d kr||7 }n td | d}q8W |dkstd |tdk s |tdkr&td|S )zConvert the text form of a TTL to an integer. The BIND 8 units syntax for TTLs (e.g. '1w6d4h3m10s') is supported. @param text: the textual TTL @type text: string @raises dns.ttl.BadTTL: the TTL is not well-formed @rtype: int r wi: diQ hi m< szunknown unit '%s'ztrailing integeriz0TTL should be between 0 and 2^31 - 1 (inclusive))isdigitr r lower)textZtotalZcurrentcr r r from_text s8 r ) r Z dns.exceptionZdnsZ_compatr Z exception SyntaxErrorr r r r r r <module> s PK g\" % __pycache__/inet.cpython-36.opt-1.pycnu [ 3 bW @ sj d Z ddlZddlZddlZejZy ejZW n ek rD dZY nX dd Zdd Z dd Z d d Z dS ) z*Generic Internet address helper functions. Ni' c C s0 | t krtjj|S | tkr(tjj|S tdS )a* Convert the textual form of a network address into its binary form. @param family: the address family @type family: int @param text: the textual address @type text: string @raises NotImplementedError: the address family specified is not implemented. @rtype: string N)AF_INETdnsipv4 inet_atonAF_INET6ipv6NotImplementedError)familytext r /usr/lib/python3.6/inet.py inet_pton& s r c C s0 | t krtjj|S | tkr(tjj|S tdS )a/ Convert the binary form of a network address into its textual form. @param family: the address family @type family: int @param address: the binary address @type address: string @raises NotImplementedError: the address family specified is not implemented. @rtype: string N)r r r Z inet_ntoar r r )r Zaddressr r r inet_ntop: s r c C sL yt jj| tS tk rF yt jj| tS tY nX Y nX dS )zDetermine the address family of a textual-form network address. @param text: the textual address @type text: string @raises ValueError: the address family cannot be determined from the input. @rtype: int N)r r r r Exceptionr r ValueError)r r r r af_for_addressM s r c C st y$t tjj| d }|dko$|dkS tk rn y t tjj| d }|dkS tk rh tY nX Y nX dS )zIs the textual-form network address a multicast address? @param text: the textual address @raises ValueError: the address family cannot be determined from the input. @rtype: bool r N)ordr r r r r r )r firstr r r is_multicast` s r ) __doc__ZsocketZdns.ipv4r Zdns.ipv6r r AttributeErrorr r r r r r r r <module> s PK g\: __pycache__/rcode.cpython-36.pycnu [ 3 bW @ s d Z ddlZddlmZ dZdZdZdZdZ dZ d Z d Z d Z d Zd ZdZeeeee e e e e eeed Zedd ej D ZG dd dejjZdd Zdd Zdd Zdd ZdS ) zDNS Result Codes. N )long ) NOERRORFORMERRSERVFAILNXDOMAINNOTIMPREFUSEDYXDOMAINYXRRSETNXRRSETNOTAUTHNOTZONEBADVERSc c s | ]\}}||fV qd S )N ).0xyr r /usr/lib/python3.6/rcode.py <genexpr>6 s r c @ s e Zd ZdZdS ) UnknownRcodezA DNS rcode is unknown.N)__name__ __module__ __qualname____doc__r r r r r 9 s r c C sB | j r$t| }|dkr$|dkr$|S tj| j }|dkr>t|S )zConvert text into an rcode. @param text: the textual rcode @type text: string @raises UnknownRcode: the rcode is unknown @rtype: int r i N)isdigitint_by_textgetupperr )textvr r r from_text> s r, c C s0 | d@ |d? d@ B }|dk s$|dkr,t d|S )zReturn the rcode value encoded by flags and ednsflags. @param flags: the DNS flags @type flags: int @param ednsflags: the EDNS flags @type ednsflags: int @raises ValueError: rcode is < 0 or > 4095 @rtype: int i r i z rcode must be >= 0 and <= 4095) ValueError)flagsZ ednsflagsvaluer r r from_flagsQ s r2 c C s8 | dk s| dkrt d| d@ }t| d@ d> }||fS )zReturn a (flags, ednsflags) tuple which encodes the rcode. @param value: the rcode @type value: int @raises ValueError: rcode is < 0 or > 4095 @rtype: (int, int) tuple r i z rcode must be >= 0 and <= 4095r- i r. )r/ r )r1 r+ Zevr r r to_flagsb s r3 c C s t j| }|dkrt| }|S )zbConvert rcode into text. @param value: the rcode @type value: int @rtype: string N) _by_valuer( str)r1 r* r r r to_textr s r6 ) r$ Z dns.exceptionZdnsZ_compatr r r r r r r r r r r r r r' dictitemsr4 Z exceptionZ DNSExceptionr r, r2 r3 r6 r r r r <module> s@ PK g\şD D $ __pycache__/exception.cpython-36.pycnu [ 3 dW @ sh d Z G dd deZG dd deZG dd deZG dd deZG d d d eZG d d d eZd S )zCommon DNS Exceptions.c sR e Zd ZdZdZe ZdZ fddZdd Z dd Z d d Z fd d Z Z S ) DNSExceptiona Abstract base class shared by all dnspython exceptions. It supports two basic modes of operation: a) Old/compatible mode is used if __init__ was called with empty **kwargs. In compatible mode all *args are passed to standard Python Exception class as before and all *args are printed by standard __str__ implementation. Class variable msg (or doc string if msg is None) is returned from str() if *args is empty. b) New/parametrized mode is used if __init__ was called with non-empty **kwargs. In the new mode *args has to be empty and all kwargs has to exactly match set in class variable self.supp_kwargs. All kwargs are stored inside self.kwargs and used in new __str__ implementation to construct formatted message based on self.fmt string. In the simplest case it is enough to override supp_kwargs and fmt class variables to get nice parametrized messages. Nc sp | j || |r*| jf || _t| | _nt | _| jd krD| j| _|rZtt| j | ntt| j | j d S )N) _check_params _check_kwargskwargsstrmsgdict__doc__superr __init__)selfargsr ) __class__ /usr/lib/python3.6/exception.pyr . s zDNSException.__init__c O s$ |s|r t |t |ks tddS )zsOld exceptions supported only args and not kwargs. For sanity we do not allow to mix old and new behavior.z=keyword arguments are mutually exclusive with positional argsN)boolAssertionError)r r r r r r r = s zDNSException._check_paramsc K s( |r$t |j | jks$td| j |S )Nz-following set of keyword args is required: %s)setkeys supp_kwargsr )r r r r r r E s zDNSException._check_kwargsc K sh i }x^|j D ]R\}}t|ttfrXttt|||< t|| dkr`|| j ||< q|||< qW |S )zFormat kwargs before printing them. Resulting dictionary has to have keys necessary for str.format call on fmt class variable. )items isinstancelistr mapr lenpop)r r fmtargskwdatar r r _fmt_kwargsL s zDNSException._fmt_kwargsc s: | j r(| jr(| jf | j }| jjf |S tt| j S d S )N)r fmtr formatr r __str__)r r )r r r r" ^ s zDNSException.__str__)__name__ __module__ __qualname__r r r r r r r r r r" __classcell__r r )r r r s r c @ s e Zd ZdZdS ) FormErrorzDNS message is malformed.N)r# r$ r% r r r r r r' h s r' c @ s e Zd ZdZdS ) SyntaxErrorzText input is malformed.N)r# r$ r% r r r r r r( m s r( c @ s e Zd ZdZdS ) UnexpectedEndz Text input ended unexpectedly.N)r# r$ r% r r r r r r) r s r) c @ s e Zd ZdZdS )TooBigzThe DNS message is too big.N)r# r$ r% r r r r r r* w s r* c @ s e Zd ZdZedgZdZdS )Timeoutz The DNS operation timed out.Ztimeoutz3The DNS operation timed out after {timeout} secondsN)r# r$ r% r r r r r r r r r+ | s r+ N)r Exceptionr r' r( r) r* r+ r r r r <module> s UPK g\b? , __pycache__/tsigkeyring.cpython-36.opt-1.pycnu [ 3 bW @ s8 d Z ddlmZmZ ddlZddlZdd Zdd ZdS )zA place to store TSIG keys. ) maybe_decode maybe_encodeNc C s< i }x2| D ]*}t jj|}tjt| | }|||< q W |S )zConvert a dictionary containing (textual DNS name, base64 secret) pairs into a binary keyring which has (dns.name.Name, binary secret) pairs. @rtype: dict)dnsname from_textbase64Z decodestringr )textringkeyringkeytextkeynamesecret r !/usr/lib/python3.6/tsigkeyring.pyr s r c C s< i }x2| D ]*}t |j }t tj| | }|||< q W |S )zConvert a dictionary containing (dns.name.Name, binary secret) pairs into a text keyring which has (textual DNS name, base64 secret) pairs. @rtype: dict)r to_textr Z encodestring)r r r r r r r r r & s r ) __doc__Z dns._compatr r r Zdns.namer r r r r r r <module> s PK g\bCI ( __pycache__/_compat.cpython-36.opt-1.pycnu [ 3 bW! @ s d dl Z d dlZd dlmZ e jd kr0eZeZneZeZe jd krfeZ e Z efZ e Zdd Zdd Zn"eZ eZ efZ eZdd Zd d Zd d ZdS ) N)Context c C s | j S )N)decode)x r /usr/lib/python3.6/_compat.py maybe_decode s r c C s | j S )N)encode)r r r r maybe_encode s r c C s | S )Nr )r r r r r s c C s | S )Nr )r r r r r s c C s, t ttt| tjdjt| }t|S )z Python 2 and Python 3 use different rounding strategies in round(). This function ensures that results are python2/3 compatible and backward compatible with previous py2 releases :param what: float :return: rounded long )ZprecZrounding)r lenstrlongdecimalZ ROUND_HALF_UPZcreate_decimal)Zwhatdr r r round_py2_compat# s r )r )r )sysr r version_infointr rangeZxranger Z text_typebytesZ binary_typeZ string_typeschrZunichrr r ZunicodeZ basestringr r r r r <module> s* PK g\V ipv6.pynu [ # Copyright (C) 2003-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. """IPv6 helper functions.""" import re import binascii import dns.exception import dns.ipv4 from ._compat import xrange, binary_type, maybe_decode _leading_zero = re.compile(b'0+([0-9a-f]+)') def inet_ntoa(address): """Convert a network format IPv6 address into text. @param address: the binary address @type address: string @rtype: string @raises ValueError: the address isn't 16 bytes long """ if len(address) != 16: raise ValueError("IPv6 addresses are 16 bytes long") hex = binascii.hexlify(address) chunks = [] i = 0 l = len(hex) while i < l: chunk = hex[i : i + 4] # strip leading zeros. we do this with an re instead of # with lstrip() because lstrip() didn't support chars until # python 2.2.2 m = _leading_zero.match(chunk) if not m is None: chunk = m.group(1) chunks.append(chunk) i += 4 # # Compress the longest subsequence of 0-value chunks to :: # best_start = 0 best_len = 0 start = -1 last_was_zero = False for i in xrange(8): if chunks[i] != b'0': if last_was_zero: end = i current_len = end - start if current_len > best_len: best_start = start best_len = current_len last_was_zero = False elif not last_was_zero: start = i last_was_zero = True if last_was_zero: end = 8 current_len = end - start if current_len > best_len: best_start = start best_len = current_len if best_len > 1: if best_start == 0 and \ (best_len == 6 or best_len == 5 and chunks[5] == b'ffff'): # We have an embedded IPv4 address if best_len == 6: prefix = b'::' else: prefix = b'::ffff:' hex = prefix + dns.ipv4.inet_ntoa(address[12:]) else: hex = b':'.join(chunks[:best_start]) + b'::' + \ b':'.join(chunks[best_start + best_len:]) else: hex = b':'.join(chunks) return maybe_decode(hex) _v4_ending = re.compile(b'(.*):(\d+\.\d+\.\d+\.\d+)$') _colon_colon_start = re.compile(b'::.*') _colon_colon_end = re.compile(b'.*::$') def inet_aton(text): """Convert a text format IPv6 address into network format. @param text: the textual address @type text: string @rtype: string @raises dns.exception.SyntaxError: the text was not properly formatted """ # # Our aim here is not something fast; we just want something that works. # if not isinstance(text, binary_type): text = text.encode() if text == b'::': text = b'0::' # # Get rid of the icky dot-quad syntax if we have it. # m = _v4_ending.match(text) if not m is None: b = bytearray(dns.ipv4.inet_aton(m.group(2))) text = (u"%s:%02x%02x:%02x%02x" % (m.group(1).decode(), b[0], b[1], b[2], b[3])).encode() # # Try to turn '::<whatever>' into ':<whatever>'; if no match try to # turn '<whatever>::' into '<whatever>:' # m = _colon_colon_start.match(text) if not m is None: text = text[1:] else: m = _colon_colon_end.match(text) if not m is None: text = text[:-1] # # Now canonicalize into 8 chunks of 4 hex digits each # chunks = text.split(b':') l = len(chunks) if l > 8: raise dns.exception.SyntaxError seen_empty = False canonical = [] for c in chunks: if c == b'': if seen_empty: raise dns.exception.SyntaxError seen_empty = True for i in xrange(0, 8 - l + 1): canonical.append(b'0000') else: lc = len(c) if lc > 4: raise dns.exception.SyntaxError if lc != 4: c = (b'0' * (4 - lc)) + c canonical.append(c) if l < 8 and not seen_empty: raise dns.exception.SyntaxError text = b''.join(canonical) # # Finally we can go to binary. # try: return binascii.unhexlify(text) except (binascii.Error, TypeError): raise dns.exception.SyntaxError _mapped_prefix = b'\x00' * 10 + b'\xff\xff' def is_mapped(address): return address.startswith(_mapped_prefix) PK g\ opcode.pynu [ # Copyright (C) 2001-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. """DNS Opcodes.""" import dns.exception QUERY = 0 IQUERY = 1 STATUS = 2 NOTIFY = 4 UPDATE = 5 _by_text = { 'QUERY': QUERY, 'IQUERY': IQUERY, 'STATUS': STATUS, 'NOTIFY': NOTIFY, 'UPDATE': UPDATE } # We construct the inverse mapping programmatically to ensure that we # cannot make any mistakes (e.g. omissions, cut-and-paste errors) that # would cause the mapping not to be true inverse. _by_value = dict((y, x) for x, y in _by_text.items()) class UnknownOpcode(dns.exception.DNSException): """An DNS opcode is unknown.""" def from_text(text): """Convert text into an opcode. @param text: the textual opcode @type text: string @raises UnknownOpcode: the opcode is unknown @rtype: int """ if text.isdigit(): value = int(text) if value >= 0 and value <= 15: return value value = _by_text.get(text.upper()) if value is None: raise UnknownOpcode return value def from_flags(flags): """Extract an opcode from DNS message flags. @param flags: int @rtype: int """ return (flags & 0x7800) >> 11 def to_flags(value): """Convert an opcode to a value suitable for ORing into DNS message flags. @rtype: int """ return (value << 11) & 0x7800 def to_text(value): """Convert an opcode to text. @param value: the opcdoe @type value: int @raises UnknownOpcode: the opcode is unknown @rtype: string """ text = _by_value.get(value) if text is None: text = str(value) return text def is_update(flags): """True if the opcode in flags is UPDATE. @param flags: DNS flags @type flags: int @rtype: bool """ return from_flags(flags) == UPDATE PK g\ji] ] namedict.pynu [ # Copyright (C) 2003-2007, 2009-2011 Nominum, Inc. # Copyright (C) 2016 Coresec Systems AB # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. # # THE SOFTWARE IS PROVIDED "AS IS" AND CORESEC SYSTEMS AB DISCLAIMS ALL # WARRANTIES WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED # WARRANTIES OF MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL CORESEC # SYSTEMS AB BE LIABLE FOR ANY SPECIAL, DIRECT, INDIRECT, OR # CONSEQUENTIAL DAMAGES OR ANY DAMAGES WHATSOEVER RESULTING FROM LOSS # OF USE, DATA OR PROFITS, WHETHER IN AN ACTION OF CONTRACT, # NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT OF OR IN CONNECTION # WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. """DNS name dictionary""" import collections import dns.name from ._compat import xrange class NameDict(collections.MutableMapping): """A dictionary whose keys are dns.name.Name objects. @ivar max_depth: the maximum depth of the keys that have ever been added to the dictionary. @type max_depth: int @ivar max_depth_items: the number of items of maximum depth @type max_depth_items: int """ __slots__ = ["max_depth", "max_depth_items", "__store"] def __init__(self, *args, **kwargs): self.__store = dict() self.max_depth = 0 self.max_depth_items = 0 self.update(dict(*args, **kwargs)) def __update_max_depth(self, key): if len(key) == self.max_depth: self.max_depth_items = self.max_depth_items + 1 elif len(key) > self.max_depth: self.max_depth = len(key) self.max_depth_items = 1 def __getitem__(self, key): return self.__store[key] def __setitem__(self, key, value): if not isinstance(key, dns.name.Name): raise ValueError('NameDict key must be a name') self.__store[key] = value self.__update_max_depth(key) def __delitem__(self, key): value = self.__store.pop(key) if len(value) == self.max_depth: self.max_depth_items = self.max_depth_items - 1 if self.max_depth_items == 0: self.max_depth = 0 for k in self.__store: self.__update_max_depth(k) def __iter__(self): return iter(self.__store) def __len__(self): return len(self.__store) def has_key(self, key): return key in self.__store def get_deepest_match(self, name): """Find the deepest match to I{name} in the dictionary. The deepest match is the longest name in the dictionary which is a superdomain of I{name}. @param name: the name @type name: dns.name.Name object @rtype: (key, value) tuple """ depth = len(name) if depth > self.max_depth: depth = self.max_depth for i in xrange(-depth, 0): n = dns.name.Name(name[i:]) if n in self: return (n, self[n]) v = self[dns.name.empty] return (dns.name.empty, v) PK g\5t wiredata.pynu [ # Copyright (C) 2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. """DNS Wire Data Helper""" import sys import dns.exception from ._compat import binary_type, string_types # Figure out what constant python passes for an unspecified slice bound. # It's supposed to be sys.maxint, yet on 64-bit windows sys.maxint is 2^31 - 1 # but Python uses 2^63 - 1 as the constant. Rather than making pointless # extra comparisons, duplicating code, or weakening WireData, we just figure # out what constant Python will use. class _SliceUnspecifiedBound(binary_type): def __getitem__(self, key): return key.stop if sys.version_info < (3,): def __getslice__(self, i, j): # pylint: disable=getslice-method return self.__getitem__(slice(i, j)) _unspecified_bound = _SliceUnspecifiedBound()[1:] class WireData(binary_type): # WireData is a string with stricter slicing def __getitem__(self, key): try: if isinstance(key, slice): # make sure we are not going outside of valid ranges, # do stricter control of boundaries than python does # by default start = key.start stop = key.stop if sys.version_info < (3,): if stop == _unspecified_bound: # handle the case where the right bound is unspecified stop = len(self) if start < 0 or stop < 0: raise dns.exception.FormError # If it's not an empty slice, access left and right bounds # to make sure they're valid if start != stop: super(WireData, self).__getitem__(start) super(WireData, self).__getitem__(stop - 1) else: for index in (start, stop): if index is None: continue elif abs(index) > len(self): raise dns.exception.FormError return WireData(super(WireData, self).__getitem__( slice(start, stop))) return bytearray(self.unwrap())[key] except IndexError: raise dns.exception.FormError if sys.version_info < (3,): def __getslice__(self, i, j): # pylint: disable=getslice-method return self.__getitem__(slice(i, j)) def __iter__(self): i = 0 while 1: try: yield self[i] i += 1 except dns.exception.FormError: raise StopIteration def unwrap(self): return binary_type(self) def maybe_wrap(wire): if isinstance(wire, WireData): return wire elif isinstance(wire, binary_type): return WireData(wire) elif isinstance(wire, string_types): return WireData(wire.encode()) raise ValueError("unhandled type %s" % type(wire)) PK g\Qy y message.pynu [ # Copyright (C) 2001-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. """DNS Messages""" from __future__ import absolute_import from io import StringIO import struct import time import dns.edns import dns.exception import dns.flags import dns.name import dns.opcode import dns.entropy import dns.rcode import dns.rdata import dns.rdataclass import dns.rdatatype import dns.rrset import dns.renderer import dns.tsig import dns.wiredata from ._compat import long, xrange, string_types class ShortHeader(dns.exception.FormError): """The DNS packet passed to from_wire() is too short.""" class TrailingJunk(dns.exception.FormError): """The DNS packet passed to from_wire() has extra junk at the end of it.""" class UnknownHeaderField(dns.exception.DNSException): """The header field name was not recognized when converting from text into a message.""" class BadEDNS(dns.exception.FormError): """OPT record occurred somewhere other than the start of the additional data section.""" class BadTSIG(dns.exception.FormError): """A TSIG record occurred somewhere other than the end of the additional data section.""" class UnknownTSIGKey(dns.exception.DNSException): """A TSIG with an unknown key was received.""" class Message(object): """A DNS message. @ivar id: The query id; the default is a randomly chosen id. @type id: int @ivar flags: The DNS flags of the message. @see: RFC 1035 for an explanation of these flags. @type flags: int @ivar question: The question section. @type question: list of dns.rrset.RRset objects @ivar answer: The answer section. @type answer: list of dns.rrset.RRset objects @ivar authority: The authority section. @type authority: list of dns.rrset.RRset objects @ivar additional: The additional data section. @type additional: list of dns.rrset.RRset objects @ivar edns: The EDNS level to use. The default is -1, no Edns. @type edns: int @ivar ednsflags: The EDNS flags @type ednsflags: long @ivar payload: The EDNS payload size. The default is 0. @type payload: int @ivar options: The EDNS options @type options: list of dns.edns.Option objects @ivar request_payload: The associated request's EDNS payload size. @type request_payload: int @ivar keyring: The TSIG keyring to use. The default is None. @type keyring: dict @ivar keyname: The TSIG keyname to use. The default is None. @type keyname: dns.name.Name object @ivar keyalgorithm: The TSIG algorithm to use; defaults to dns.tsig.default_algorithm. Constants for TSIG algorithms are defined in dns.tsig, and the currently implemented algorithms are HMAC_MD5, HMAC_SHA1, HMAC_SHA224, HMAC_SHA256, HMAC_SHA384, and HMAC_SHA512. @type keyalgorithm: string @ivar request_mac: The TSIG MAC of the request message associated with this message; used when validating TSIG signatures. @see: RFC 2845 for more information on TSIG fields. @type request_mac: string @ivar fudge: TSIG time fudge; default is 300 seconds. @type fudge: int @ivar original_id: TSIG original id; defaults to the message's id @type original_id: int @ivar tsig_error: TSIG error code; default is 0. @type tsig_error: int @ivar other_data: TSIG other data. @type other_data: string @ivar mac: The TSIG MAC for this message. @type mac: string @ivar xfr: Is the message being used to contain the results of a DNS zone transfer? The default is False. @type xfr: bool @ivar origin: The origin of the zone in messages which are used for zone transfers or for DNS dynamic updates. The default is None. @type origin: dns.name.Name object @ivar tsig_ctx: The TSIG signature context associated with this message. The default is None. @type tsig_ctx: hmac.HMAC object @ivar had_tsig: Did the message decoded from wire format have a TSIG signature? @type had_tsig: bool @ivar multi: Is this message part of a multi-message sequence? The default is false. This variable is used when validating TSIG signatures on messages which are part of a zone transfer. @type multi: bool @ivar first: Is this message standalone, or the first of a multi message sequence? This variable is used when validating TSIG signatures on messages which are part of a zone transfer. @type first: bool @ivar index: An index of rrsets in the message. The index key is (section, name, rdclass, rdtype, covers, deleting). Indexing can be disabled by setting the index to None. @type index: dict """ def __init__(self, id=None): if id is None: self.id = dns.entropy.random_16() else: self.id = id self.flags = 0 self.question = [] self.answer = [] self.authority = [] self.additional = [] self.edns = -1 self.ednsflags = 0 self.payload = 0 self.options = [] self.request_payload = 0 self.keyring = None self.keyname = None self.keyalgorithm = dns.tsig.default_algorithm self.request_mac = '' self.other_data = '' self.tsig_error = 0 self.fudge = 300 self.original_id = self.id self.mac = '' self.xfr = False self.origin = None self.tsig_ctx = None self.had_tsig = False self.multi = False self.first = True self.index = {} def __repr__(self): return '<DNS message, ID ' + repr(self.id) + '>' def __str__(self): return self.to_text() def to_text(self, origin=None, relativize=True, **kw): """Convert the message to text. The I{origin}, I{relativize}, and any other keyword arguments are passed to the rrset to_wire() method. @rtype: string """ s = StringIO() s.write(u'id %d\n' % self.id) s.write(u'opcode %s\n' % dns.opcode.to_text(dns.opcode.from_flags(self.flags))) rc = dns.rcode.from_flags(self.flags, self.ednsflags) s.write(u'rcode %s\n' % dns.rcode.to_text(rc)) s.write(u'flags %s\n' % dns.flags.to_text(self.flags)) if self.edns >= 0: s.write(u'edns %s\n' % self.edns) if self.ednsflags != 0: s.write(u'eflags %s\n' % dns.flags.edns_to_text(self.ednsflags)) s.write(u'payload %d\n' % self.payload) is_update = dns.opcode.is_update(self.flags) if is_update: s.write(u';ZONE\n') else: s.write(u';QUESTION\n') for rrset in self.question: s.write(rrset.to_text(origin, relativize, **kw)) s.write(u'\n') if is_update: s.write(u';PREREQ\n') else: s.write(u';ANSWER\n') for rrset in self.answer: s.write(rrset.to_text(origin, relativize, **kw)) s.write(u'\n') if is_update: s.write(u';UPDATE\n') else: s.write(u';AUTHORITY\n') for rrset in self.authority: s.write(rrset.to_text(origin, relativize, **kw)) s.write(u'\n') s.write(u';ADDITIONAL\n') for rrset in self.additional: s.write(rrset.to_text(origin, relativize, **kw)) s.write(u'\n') # # We strip off the final \n so the caller can print the result without # doing weird things to get around eccentricities in Python print # formatting # return s.getvalue()[:-1] def __eq__(self, other): """Two messages are equal if they have the same content in the header, question, answer, and authority sections. @rtype: bool""" if not isinstance(other, Message): return False if self.id != other.id: return False if self.flags != other.flags: return False for n in self.question: if n not in other.question: return False for n in other.question: if n not in self.question: return False for n in self.answer: if n not in other.answer: return False for n in other.answer: if n not in self.answer: return False for n in self.authority: if n not in other.authority: return False for n in other.authority: if n not in self.authority: return False return True def __ne__(self, other): """Are two messages not equal? @rtype: bool""" return not self.__eq__(other) def is_response(self, other): """Is other a response to self? @rtype: bool""" if other.flags & dns.flags.QR == 0 or \ self.id != other.id or \ dns.opcode.from_flags(self.flags) != \ dns.opcode.from_flags(other.flags): return False if dns.rcode.from_flags(other.flags, other.ednsflags) != \ dns.rcode.NOERROR: return True if dns.opcode.is_update(self.flags): return True for n in self.question: if n not in other.question: return False for n in other.question: if n not in self.question: return False return True def section_number(self, section): if section is self.question: return 0 elif section is self.answer: return 1 elif section is self.authority: return 2 elif section is self.additional: return 3 else: raise ValueError('unknown section') def find_rrset(self, section, name, rdclass, rdtype, covers=dns.rdatatype.NONE, deleting=None, create=False, force_unique=False): """Find the RRset with the given attributes in the specified section. @param section: the section of the message to look in, e.g. self.answer. @type section: list of dns.rrset.RRset objects @param name: the name of the RRset @type name: dns.name.Name object @param rdclass: the class of the RRset @type rdclass: int @param rdtype: the type of the RRset @type rdtype: int @param covers: the covers value of the RRset @type covers: int @param deleting: the deleting value of the RRset @type deleting: int @param create: If True, create the RRset if it is not found. The created RRset is appended to I{section}. @type create: bool @param force_unique: If True and create is also True, create a new RRset regardless of whether a matching RRset exists already. @type force_unique: bool @raises KeyError: the RRset was not found and create was False @rtype: dns.rrset.RRset object""" key = (self.section_number(section), name, rdclass, rdtype, covers, deleting) if not force_unique: if self.index is not None: rrset = self.index.get(key) if rrset is not None: return rrset else: for rrset in section: if rrset.match(name, rdclass, rdtype, covers, deleting): return rrset if not create: raise KeyError rrset = dns.rrset.RRset(name, rdclass, rdtype, covers, deleting) section.append(rrset) if self.index is not None: self.index[key] = rrset return rrset def get_rrset(self, section, name, rdclass, rdtype, covers=dns.rdatatype.NONE, deleting=None, create=False, force_unique=False): """Get the RRset with the given attributes in the specified section. If the RRset is not found, None is returned. @param section: the section of the message to look in, e.g. self.answer. @type section: list of dns.rrset.RRset objects @param name: the name of the RRset @type name: dns.name.Name object @param rdclass: the class of the RRset @type rdclass: int @param rdtype: the type of the RRset @type rdtype: int @param covers: the covers value of the RRset @type covers: int @param deleting: the deleting value of the RRset @type deleting: int @param create: If True, create the RRset if it is not found. The created RRset is appended to I{section}. @type create: bool @param force_unique: If True and create is also True, create a new RRset regardless of whether a matching RRset exists already. @type force_unique: bool @rtype: dns.rrset.RRset object or None""" try: rrset = self.find_rrset(section, name, rdclass, rdtype, covers, deleting, create, force_unique) except KeyError: rrset = None return rrset def to_wire(self, origin=None, max_size=0, **kw): """Return a string containing the message in DNS compressed wire format. Additional keyword arguments are passed to the rrset to_wire() method. @param origin: The origin to be appended to any relative names. @type origin: dns.name.Name object @param max_size: The maximum size of the wire format output; default is 0, which means 'the message's request payload, if nonzero, or 65536'. @type max_size: int @raises dns.exception.TooBig: max_size was exceeded @rtype: string """ if max_size == 0: if self.request_payload != 0: max_size = self.request_payload else: max_size = 65535 if max_size < 512: max_size = 512 elif max_size > 65535: max_size = 65535 r = dns.renderer.Renderer(self.id, self.flags, max_size, origin) for rrset in self.question: r.add_question(rrset.name, rrset.rdtype, rrset.rdclass) for rrset in self.answer: r.add_rrset(dns.renderer.ANSWER, rrset, **kw) for rrset in self.authority: r.add_rrset(dns.renderer.AUTHORITY, rrset, **kw) if self.edns >= 0: r.add_edns(self.edns, self.ednsflags, self.payload, self.options) for rrset in self.additional: r.add_rrset(dns.renderer.ADDITIONAL, rrset, **kw) r.write_header() if self.keyname is not None: r.add_tsig(self.keyname, self.keyring[self.keyname], self.fudge, self.original_id, self.tsig_error, self.other_data, self.request_mac, self.keyalgorithm) self.mac = r.mac return r.get_wire() def use_tsig(self, keyring, keyname=None, fudge=300, original_id=None, tsig_error=0, other_data='', algorithm=dns.tsig.default_algorithm): """When sending, a TSIG signature using the specified keyring and keyname should be added. @param keyring: The TSIG keyring to use; defaults to None. @type keyring: dict @param keyname: The name of the TSIG key to use; defaults to None. The key must be defined in the keyring. If a keyring is specified but a keyname is not, then the key used will be the first key in the keyring. Note that the order of keys in a dictionary is not defined, so applications should supply a keyname when a keyring is used, unless they know the keyring contains only one key. @type keyname: dns.name.Name or string @param fudge: TSIG time fudge; default is 300 seconds. @type fudge: int @param original_id: TSIG original id; defaults to the message's id @type original_id: int @param tsig_error: TSIG error code; default is 0. @type tsig_error: int @param other_data: TSIG other data. @type other_data: string @param algorithm: The TSIG algorithm to use; defaults to dns.tsig.default_algorithm """ self.keyring = keyring if keyname is None: self.keyname = list(self.keyring.keys())[0] else: if isinstance(keyname, string_types): keyname = dns.name.from_text(keyname) self.keyname = keyname self.keyalgorithm = algorithm self.fudge = fudge if original_id is None: self.original_id = self.id else: self.original_id = original_id self.tsig_error = tsig_error self.other_data = other_data def use_edns(self, edns=0, ednsflags=0, payload=1280, request_payload=None, options=None): """Configure EDNS behavior. @param edns: The EDNS level to use. Specifying None, False, or -1 means 'do not use EDNS', and in this case the other parameters are ignored. Specifying True is equivalent to specifying 0, i.e. 'use EDNS0'. @type edns: int or bool or None @param ednsflags: EDNS flag values. @type ednsflags: int @param payload: The EDNS sender's payload field, which is the maximum size of UDP datagram the sender can handle. @type payload: int @param request_payload: The EDNS payload size to use when sending this message. If not specified, defaults to the value of payload. @type request_payload: int or None @param options: The EDNS options @type options: None or list of dns.edns.Option objects @see: RFC 2671 """ if edns is None or edns is False: edns = -1 if edns is True: edns = 0 if request_payload is None: request_payload = payload if edns < 0: ednsflags = 0 payload = 0 request_payload = 0 options = [] else: # make sure the EDNS version in ednsflags agrees with edns ednsflags &= long(0xFF00FFFF) ednsflags |= (edns << 16) if options is None: options = [] self.edns = edns self.ednsflags = ednsflags self.payload = payload self.options = options self.request_payload = request_payload def want_dnssec(self, wanted=True): """Enable or disable 'DNSSEC desired' flag in requests. @param wanted: Is DNSSEC desired? If True, EDNS is enabled if required, and then the DO bit is set. If False, the DO bit is cleared if EDNS is enabled. @type wanted: bool """ if wanted: if self.edns < 0: self.use_edns() self.ednsflags |= dns.flags.DO elif self.edns >= 0: self.ednsflags &= ~dns.flags.DO def rcode(self): """Return the rcode. @rtype: int """ return dns.rcode.from_flags(self.flags, self.ednsflags) def set_rcode(self, rcode): """Set the rcode. @param rcode: the rcode @type rcode: int """ (value, evalue) = dns.rcode.to_flags(rcode) self.flags &= 0xFFF0 self.flags |= value self.ednsflags &= long(0x00FFFFFF) self.ednsflags |= evalue if self.ednsflags != 0 and self.edns < 0: self.edns = 0 def opcode(self): """Return the opcode. @rtype: int """ return dns.opcode.from_flags(self.flags) def set_opcode(self, opcode): """Set the opcode. @param opcode: the opcode @type opcode: int """ self.flags &= 0x87FF self.flags |= dns.opcode.to_flags(opcode) class _WireReader(object): """Wire format reader. @ivar wire: the wire-format message. @type wire: string @ivar message: The message object being built @type message: dns.message.Message object @ivar current: When building a message object from wire format, this variable contains the offset from the beginning of wire of the next octet to be read. @type current: int @ivar updating: Is the message a dynamic update? @type updating: bool @ivar one_rr_per_rrset: Put each RR into its own RRset? @type one_rr_per_rrset: bool @ivar ignore_trailing: Ignore trailing junk at end of request? @type ignore_trailing: bool @ivar zone_rdclass: The class of the zone in messages which are DNS dynamic updates. @type zone_rdclass: int """ def __init__(self, wire, message, question_only=False, one_rr_per_rrset=False, ignore_trailing=False): self.wire = dns.wiredata.maybe_wrap(wire) self.message = message self.current = 0 self.updating = False self.zone_rdclass = dns.rdataclass.IN self.question_only = question_only self.one_rr_per_rrset = one_rr_per_rrset self.ignore_trailing = ignore_trailing def _get_question(self, qcount): """Read the next I{qcount} records from the wire data and add them to the question section. @param qcount: the number of questions in the message @type qcount: int""" if self.updating and qcount > 1: raise dns.exception.FormError for i in xrange(0, qcount): (qname, used) = dns.name.from_wire(self.wire, self.current) if self.message.origin is not None: qname = qname.relativize(self.message.origin) self.current = self.current + used (rdtype, rdclass) = \ struct.unpack('!HH', self.wire[self.current:self.current + 4]) self.current = self.current + 4 self.message.find_rrset(self.message.question, qname, rdclass, rdtype, create=True, force_unique=True) if self.updating: self.zone_rdclass = rdclass def _get_section(self, section, count): """Read the next I{count} records from the wire data and add them to the specified section. @param section: the section of the message to which to add records @type section: list of dns.rrset.RRset objects @param count: the number of records to read @type count: int""" if self.updating or self.one_rr_per_rrset: force_unique = True else: force_unique = False seen_opt = False for i in xrange(0, count): rr_start = self.current (name, used) = dns.name.from_wire(self.wire, self.current) absolute_name = name if self.message.origin is not None: name = name.relativize(self.message.origin) self.current = self.current + used (rdtype, rdclass, ttl, rdlen) = \ struct.unpack('!HHIH', self.wire[self.current:self.current + 10]) self.current = self.current + 10 if rdtype == dns.rdatatype.OPT: if section is not self.message.additional or seen_opt: raise BadEDNS self.message.payload = rdclass self.message.ednsflags = ttl self.message.edns = (ttl & 0xff0000) >> 16 self.message.options = [] current = self.current optslen = rdlen while optslen > 0: (otype, olen) = \ struct.unpack('!HH', self.wire[current:current + 4]) current = current + 4 opt = dns.edns.option_from_wire( otype, self.wire, current, olen) self.message.options.append(opt) current = current + olen optslen = optslen - 4 - olen seen_opt = True elif rdtype == dns.rdatatype.TSIG: if not (section is self.message.additional and i == (count - 1)): raise BadTSIG if self.message.keyring is None: raise UnknownTSIGKey('got signed message without keyring') secret = self.message.keyring.get(absolute_name) if secret is None: raise UnknownTSIGKey("key '%s' unknown" % name) self.message.keyname = absolute_name (self.message.keyalgorithm, self.message.mac) = \ dns.tsig.get_algorithm_and_mac(self.wire, self.current, rdlen) self.message.tsig_ctx = \ dns.tsig.validate(self.wire, absolute_name, secret, int(time.time()), self.message.request_mac, rr_start, self.current, rdlen, self.message.tsig_ctx, self.message.multi, self.message.first) self.message.had_tsig = True else: if ttl < 0: ttl = 0 if self.updating and \ (rdclass == dns.rdataclass.ANY or rdclass == dns.rdataclass.NONE): deleting = rdclass rdclass = self.zone_rdclass else: deleting = None if deleting == dns.rdataclass.ANY or \ (deleting == dns.rdataclass.NONE and section is self.message.answer): covers = dns.rdatatype.NONE rd = None else: rd = dns.rdata.from_wire(rdclass, rdtype, self.wire, self.current, rdlen, self.message.origin) covers = rd.covers() if self.message.xfr and rdtype == dns.rdatatype.SOA: force_unique = True rrset = self.message.find_rrset(section, name, rdclass, rdtype, covers, deleting, True, force_unique) if rd is not None: rrset.add(rd, ttl) self.current = self.current + rdlen def read(self): """Read a wire format DNS message and build a dns.message.Message object.""" l = len(self.wire) if l < 12: raise ShortHeader (self.message.id, self.message.flags, qcount, ancount, aucount, adcount) = struct.unpack('!HHHHHH', self.wire[:12]) self.current = 12 if dns.opcode.is_update(self.message.flags): self.updating = True self._get_question(qcount) if self.question_only: return self._get_section(self.message.answer, ancount) self._get_section(self.message.authority, aucount) self._get_section(self.message.additional, adcount) if not self.ignore_trailing and self.current != l: raise TrailingJunk if self.message.multi and self.message.tsig_ctx and \ not self.message.had_tsig: self.message.tsig_ctx.update(self.wire) def from_wire(wire, keyring=None, request_mac='', xfr=False, origin=None, tsig_ctx=None, multi=False, first=True, question_only=False, one_rr_per_rrset=False, ignore_trailing=False): """Convert a DNS wire format message into a message object. @param keyring: The keyring to use if the message is signed. @type keyring: dict @param request_mac: If the message is a response to a TSIG-signed request, I{request_mac} should be set to the MAC of that request. @type request_mac: string @param xfr: Is this message part of a zone transfer? @type xfr: bool @param origin: If the message is part of a zone transfer, I{origin} should be the origin name of the zone. @type origin: dns.name.Name object @param tsig_ctx: The ongoing TSIG context, used when validating zone transfers. @type tsig_ctx: hmac.HMAC object @param multi: Is this message part of a multiple message sequence? @type multi: bool @param first: Is this message standalone, or the first of a multi message sequence? @type first: bool @param question_only: Read only up to the end of the question section? @type question_only: bool @param one_rr_per_rrset: Put each RR into its own RRset @type one_rr_per_rrset: bool @param ignore_trailing: Ignore trailing junk at end of request? @type ignore_trailing: bool @raises ShortHeader: The message is less than 12 octets long. @raises TrailingJunk: There were octets in the message past the end of the proper DNS message. @raises BadEDNS: An OPT record was in the wrong section, or occurred more than once. @raises BadTSIG: A TSIG record was not the last record of the additional data section. @rtype: dns.message.Message object""" m = Message(id=0) m.keyring = keyring m.request_mac = request_mac m.xfr = xfr m.origin = origin m.tsig_ctx = tsig_ctx m.multi = multi m.first = first reader = _WireReader(wire, m, question_only, one_rr_per_rrset, ignore_trailing) reader.read() return m class _TextReader(object): """Text format reader. @ivar tok: the tokenizer @type tok: dns.tokenizer.Tokenizer object @ivar message: The message object being built @type message: dns.message.Message object @ivar updating: Is the message a dynamic update? @type updating: bool @ivar zone_rdclass: The class of the zone in messages which are DNS dynamic updates. @type zone_rdclass: int @ivar last_name: The most recently read name when building a message object from text format. @type last_name: dns.name.Name object """ def __init__(self, text, message): self.message = message self.tok = dns.tokenizer.Tokenizer(text) self.last_name = None self.zone_rdclass = dns.rdataclass.IN self.updating = False def _header_line(self, section): """Process one line from the text format header section.""" token = self.tok.get() what = token.value if what == 'id': self.message.id = self.tok.get_int() elif what == 'flags': while True: token = self.tok.get() if not token.is_identifier(): self.tok.unget(token) break self.message.flags = self.message.flags | \ dns.flags.from_text(token.value) if dns.opcode.is_update(self.message.flags): self.updating = True elif what == 'edns': self.message.edns = self.tok.get_int() self.message.ednsflags = self.message.ednsflags | \ (self.message.edns << 16) elif what == 'eflags': if self.message.edns < 0: self.message.edns = 0 while True: token = self.tok.get() if not token.is_identifier(): self.tok.unget(token) break self.message.ednsflags = self.message.ednsflags | \ dns.flags.edns_from_text(token.value) elif what == 'payload': self.message.payload = self.tok.get_int() if self.message.edns < 0: self.message.edns = 0 elif what == 'opcode': text = self.tok.get_string() self.message.flags = self.message.flags | \ dns.opcode.to_flags(dns.opcode.from_text(text)) elif what == 'rcode': text = self.tok.get_string() self.message.set_rcode(dns.rcode.from_text(text)) else: raise UnknownHeaderField self.tok.get_eol() def _question_line(self, section): """Process one line from the text format question section.""" token = self.tok.get(want_leading=True) if not token.is_whitespace(): self.last_name = dns.name.from_text(token.value, None) name = self.last_name token = self.tok.get() if not token.is_identifier(): raise dns.exception.SyntaxError # Class try: rdclass = dns.rdataclass.from_text(token.value) token = self.tok.get() if not token.is_identifier(): raise dns.exception.SyntaxError except dns.exception.SyntaxError: raise dns.exception.SyntaxError except Exception: rdclass = dns.rdataclass.IN # Type rdtype = dns.rdatatype.from_text(token.value) self.message.find_rrset(self.message.question, name, rdclass, rdtype, create=True, force_unique=True) if self.updating: self.zone_rdclass = rdclass self.tok.get_eol() def _rr_line(self, section): """Process one line from the text format answer, authority, or additional data sections. """ deleting = None # Name token = self.tok.get(want_leading=True) if not token.is_whitespace(): self.last_name = dns.name.from_text(token.value, None) name = self.last_name token = self.tok.get() if not token.is_identifier(): raise dns.exception.SyntaxError # TTL try: ttl = int(token.value, 0) token = self.tok.get() if not token.is_identifier(): raise dns.exception.SyntaxError except dns.exception.SyntaxError: raise dns.exception.SyntaxError except Exception: ttl = 0 # Class try: rdclass = dns.rdataclass.from_text(token.value) token = self.tok.get() if not token.is_identifier(): raise dns.exception.SyntaxError if rdclass == dns.rdataclass.ANY or rdclass == dns.rdataclass.NONE: deleting = rdclass rdclass = self.zone_rdclass except dns.exception.SyntaxError: raise dns.exception.SyntaxError except Exception: rdclass = dns.rdataclass.IN # Type rdtype = dns.rdatatype.from_text(token.value) token = self.tok.get() if not token.is_eol_or_eof(): self.tok.unget(token) rd = dns.rdata.from_text(rdclass, rdtype, self.tok, None) covers = rd.covers() else: rd = None covers = dns.rdatatype.NONE rrset = self.message.find_rrset(section, name, rdclass, rdtype, covers, deleting, True, self.updating) if rd is not None: rrset.add(rd, ttl) def read(self): """Read a text format DNS message and build a dns.message.Message object.""" line_method = self._header_line section = None while 1: token = self.tok.get(True, True) if token.is_eol_or_eof(): break if token.is_comment(): u = token.value.upper() if u == 'HEADER': line_method = self._header_line elif u == 'QUESTION' or u == 'ZONE': line_method = self._question_line section = self.message.question elif u == 'ANSWER' or u == 'PREREQ': line_method = self._rr_line section = self.message.answer elif u == 'AUTHORITY' or u == 'UPDATE': line_method = self._rr_line section = self.message.authority elif u == 'ADDITIONAL': line_method = self._rr_line section = self.message.additional self.tok.get_eol() continue self.tok.unget(token) line_method(section) def from_text(text): """Convert the text format message into a message object. @param text: The text format message. @type text: string @raises UnknownHeaderField: @raises dns.exception.SyntaxError: @rtype: dns.message.Message object""" # 'text' can also be a file, but we don't publish that fact # since it's an implementation detail. The official file # interface is from_file(). m = Message() reader = _TextReader(text, m) reader.read() return m def from_file(f): """Read the next text format message from the specified file. @param f: file or string. If I{f} is a string, it is treated as the name of a file to open. @raises UnknownHeaderField: @raises dns.exception.SyntaxError: @rtype: dns.message.Message object""" str_type = string_types opts = 'rU' if isinstance(f, str_type): f = open(f, opts) want_close = True else: want_close = False try: m = from_text(f) finally: if want_close: f.close() return m def make_query(qname, rdtype, rdclass=dns.rdataclass.IN, use_edns=None, want_dnssec=False, ednsflags=None, payload=None, request_payload=None, options=None): """Make a query message. The query name, type, and class may all be specified either as objects of the appropriate type, or as strings. The query will have a randomly chosen query id, and its DNS flags will be set to dns.flags.RD. @param qname: The query name. @type qname: dns.name.Name object or string @param rdtype: The desired rdata type. @type rdtype: int @param rdclass: The desired rdata class; the default is class IN. @type rdclass: int @param use_edns: The EDNS level to use; the default is None (no EDNS). See the description of dns.message.Message.use_edns() for the possible values for use_edns and their meanings. @type use_edns: int or bool or None @param want_dnssec: Should the query indicate that DNSSEC is desired? @type want_dnssec: bool @param ednsflags: EDNS flag values. @type ednsflags: int @param payload: The EDNS sender's payload field, which is the maximum size of UDP datagram the sender can handle. @type payload: int @param request_payload: The EDNS payload size to use when sending this message. If not specified, defaults to the value of payload. @type request_payload: int or None @param options: The EDNS options @type options: None or list of dns.edns.Option objects @see: RFC 2671 @rtype: dns.message.Message object""" if isinstance(qname, string_types): qname = dns.name.from_text(qname) if isinstance(rdtype, string_types): rdtype = dns.rdatatype.from_text(rdtype) if isinstance(rdclass, string_types): rdclass = dns.rdataclass.from_text(rdclass) m = Message() m.flags |= dns.flags.RD m.find_rrset(m.question, qname, rdclass, rdtype, create=True, force_unique=True) # only pass keywords on to use_edns if they have been set to a # non-None value. Setting a field will turn EDNS on if it hasn't # been configured. kwargs = {} if ednsflags is not None: kwargs['ednsflags'] = ednsflags if use_edns is None: use_edns = 0 if payload is not None: kwargs['payload'] = payload if use_edns is None: use_edns = 0 if request_payload is not None: kwargs['request_payload'] = request_payload if use_edns is None: use_edns = 0 if options is not None: kwargs['options'] = options if use_edns is None: use_edns = 0 kwargs['edns'] = use_edns m.use_edns(**kwargs) m.want_dnssec(want_dnssec) return m def make_response(query, recursion_available=False, our_payload=8192, fudge=300): """Make a message which is a response for the specified query. The message returned is really a response skeleton; it has all of the infrastructure required of a response, but none of the content. The response's question section is a shallow copy of the query's question section, so the query's question RRsets should not be changed. @param query: the query to respond to @type query: dns.message.Message object @param recursion_available: should RA be set in the response? @type recursion_available: bool @param our_payload: payload size to advertise in EDNS responses; default is 8192. @type our_payload: int @param fudge: TSIG time fudge; default is 300 seconds. @type fudge: int @rtype: dns.message.Message object""" if query.flags & dns.flags.QR: raise dns.exception.FormError('specified query message is not a query') response = dns.message.Message(query.id) response.flags = dns.flags.QR | (query.flags & dns.flags.RD) if recursion_available: response.flags |= dns.flags.RA response.set_opcode(query.opcode()) response.question = list(query.question) if query.edns >= 0: response.use_edns(0, 0, our_payload, query.payload) if query.had_tsig: response.use_tsig(query.keyring, query.keyname, fudge, None, 0, '', query.keyalgorithm) response.request_mac = query.mac return response PK g\^Is tsigkeyring.pynu [ # Copyright (C) 2003-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. """A place to store TSIG keys.""" from dns._compat import maybe_decode, maybe_encode import base64 import dns.name def from_text(textring): """Convert a dictionary containing (textual DNS name, base64 secret) pairs into a binary keyring which has (dns.name.Name, binary secret) pairs. @rtype: dict""" keyring = {} for keytext in textring: keyname = dns.name.from_text(keytext) secret = base64.decodestring(maybe_encode(textring[keytext])) keyring[keyname] = secret return keyring def to_text(keyring): """Convert a dictionary containing (dns.name.Name, binary secret) pairs into a text keyring which has (textual DNS name, base64 secret) pairs. @rtype: dict""" textring = {} for keyname in keyring: keytext = maybe_decode(keyname.to_text()) secret = maybe_decode(base64.encodestring(keyring[keyname])) textring[keytext] = secret return textring PK g\קq q entropy.pynu [ # Copyright (C) 2009, 2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. import os import random import time from ._compat import long, binary_type try: import threading as _threading except ImportError: import dummy_threading as _threading class EntropyPool(object): def __init__(self, seed=None): self.pool_index = 0 self.digest = None self.next_byte = 0 self.lock = _threading.Lock() try: import hashlib self.hash = hashlib.sha1() self.hash_len = 20 except ImportError: try: import sha self.hash = sha.new() self.hash_len = 20 except ImportError: import md5 # pylint: disable=import-error self.hash = md5.new() self.hash_len = 16 self.pool = bytearray(b'\0' * self.hash_len) if seed is not None: self.stir(bytearray(seed)) self.seeded = True self.seed_pid = os.getpid() else: self.seeded = False self.seed_pid = 0 def stir(self, entropy, already_locked=False): if not already_locked: self.lock.acquire() try: for c in entropy: if self.pool_index == self.hash_len: self.pool_index = 0 b = c & 0xff self.pool[self.pool_index] ^= b self.pool_index += 1 finally: if not already_locked: self.lock.release() def _maybe_seed(self): if not self.seeded or self.seed_pid != os.getpid(): try: seed = os.urandom(16) except Exception: try: r = open('/dev/urandom', 'rb', 0) try: seed = r.read(16) finally: r.close() except Exception: seed = str(time.time()) self.seeded = True self.seed_pid = os.getpid() self.digest = None seed = bytearray(seed) self.stir(seed, True) def random_8(self): self.lock.acquire() try: self._maybe_seed() if self.digest is None or self.next_byte == self.hash_len: self.hash.update(binary_type(self.pool)) self.digest = bytearray(self.hash.digest()) self.stir(self.digest, True) self.next_byte = 0 value = self.digest[self.next_byte] self.next_byte += 1 finally: self.lock.release() return value def random_16(self): return self.random_8() * 256 + self.random_8() def random_32(self): return self.random_16() * 65536 + self.random_16() def random_between(self, first, last): size = last - first + 1 if size > long(4294967296): raise ValueError('too big') if size > 65536: rand = self.random_32 max = long(4294967295) elif size > 256: rand = self.random_16 max = 65535 else: rand = self.random_8 max = 255 return first + size * rand() // (max + 1) pool = EntropyPool() try: system_random = random.SystemRandom() except Exception: system_random = None def random_16(): if system_random is not None: return system_random.randrange(0, 65536) else: return pool.random_16() def between(first, last): if system_random is not None: return system_random.randrange(first, last + 1) else: return pool.random_between(first, last) PK g\X2 reversename.pynu [ # Copyright (C) 2006, 2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. """DNS Reverse Map Names. @var ipv4_reverse_domain: The DNS IPv4 reverse-map domain, in-addr.arpa. @type ipv4_reverse_domain: dns.name.Name object @var ipv6_reverse_domain: The DNS IPv6 reverse-map domain, ip6.arpa. @type ipv6_reverse_domain: dns.name.Name object """ import binascii import sys import dns.name import dns.ipv6 import dns.ipv4 ipv4_reverse_domain = dns.name.from_text('in-addr.arpa.') ipv6_reverse_domain = dns.name.from_text('ip6.arpa.') def from_address(text): """Convert an IPv4 or IPv6 address in textual form into a Name object whose value is the reverse-map domain name of the address. @param text: an IPv4 or IPv6 address in textual form (e.g. '127.0.0.1', '::1') @type text: str @rtype: dns.name.Name object """ try: v6 = dns.ipv6.inet_aton(text) if dns.ipv6.is_mapped(v6): if sys.version_info >= (3,): parts = ['%d' % byte for byte in v6[12:]] else: parts = ['%d' % ord(byte) for byte in v6[12:]] origin = ipv4_reverse_domain else: parts = [x for x in str(binascii.hexlify(v6).decode())] origin = ipv6_reverse_domain except Exception: parts = ['%d' % byte for byte in bytearray(dns.ipv4.inet_aton(text))] origin = ipv4_reverse_domain parts.reverse() return dns.name.from_text('.'.join(parts), origin=origin) def to_address(name): """Convert a reverse map domain name into textual address form. @param name: an IPv4 or IPv6 address in reverse-map form. @type name: dns.name.Name object @rtype: str """ if name.is_subdomain(ipv4_reverse_domain): name = name.relativize(ipv4_reverse_domain) labels = list(name.labels) labels.reverse() text = b'.'.join(labels) # run through inet_aton() to check syntax and make pretty. return dns.ipv4.inet_ntoa(dns.ipv4.inet_aton(text)) elif name.is_subdomain(ipv6_reverse_domain): name = name.relativize(ipv6_reverse_domain) labels = list(name.labels) labels.reverse() parts = [] i = 0 l = len(labels) while i < l: parts.append(b''.join(labels[i:i + 4])) i += 4 text = b':'.join(parts) # run through inet_aton() to check syntax and make pretty. return dns.ipv6.inet_ntoa(dns.ipv6.inet_aton(text)) else: raise dns.exception.SyntaxError('unknown reverse-map address family') PK g\ ' ' update.pynu [ # Copyright (C) 2003-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. """DNS Dynamic Update Support""" import dns.message import dns.name import dns.opcode import dns.rdata import dns.rdataclass import dns.rdataset import dns.tsig from ._compat import string_types class Update(dns.message.Message): def __init__(self, zone, rdclass=dns.rdataclass.IN, keyring=None, keyname=None, keyalgorithm=dns.tsig.default_algorithm): """Initialize a new DNS Update object. @param zone: The zone which is being updated. @type zone: A dns.name.Name or string @param rdclass: The class of the zone; defaults to dns.rdataclass.IN. @type rdclass: An int designating the class, or a string whose value is the name of a class. @param keyring: The TSIG keyring to use; defaults to None. @type keyring: dict @param keyname: The name of the TSIG key to use; defaults to None. The key must be defined in the keyring. If a keyring is specified but a keyname is not, then the key used will be the first key in the keyring. Note that the order of keys in a dictionary is not defined, so applications should supply a keyname when a keyring is used, unless they know the keyring contains only one key. @type keyname: dns.name.Name or string @param keyalgorithm: The TSIG algorithm to use; defaults to dns.tsig.default_algorithm. Constants for TSIG algorithms are defined in dns.tsig, and the currently implemented algorithms are HMAC_MD5, HMAC_SHA1, HMAC_SHA224, HMAC_SHA256, HMAC_SHA384, and HMAC_SHA512. @type keyalgorithm: string """ super(Update, self).__init__() self.flags |= dns.opcode.to_flags(dns.opcode.UPDATE) if isinstance(zone, string_types): zone = dns.name.from_text(zone) self.origin = zone if isinstance(rdclass, string_types): rdclass = dns.rdataclass.from_text(rdclass) self.zone_rdclass = rdclass self.find_rrset(self.question, self.origin, rdclass, dns.rdatatype.SOA, create=True, force_unique=True) if keyring is not None: self.use_tsig(keyring, keyname, algorithm=keyalgorithm) def _add_rr(self, name, ttl, rd, deleting=None, section=None): """Add a single RR to the update section.""" if section is None: section = self.authority covers = rd.covers() rrset = self.find_rrset(section, name, self.zone_rdclass, rd.rdtype, covers, deleting, True, True) rrset.add(rd, ttl) def _add(self, replace, section, name, *args): """Add records. The first argument is the replace mode. If false, RRs are added to an existing RRset; if true, the RRset is replaced with the specified contents. The second argument is the section to add to. The third argument is always a name. The other arguments can be: - rdataset... - ttl, rdata... - ttl, rdtype, string...""" if isinstance(name, string_types): name = dns.name.from_text(name, None) if isinstance(args[0], dns.rdataset.Rdataset): for rds in args: if replace: self.delete(name, rds.rdtype) for rd in rds: self._add_rr(name, rds.ttl, rd, section=section) else: args = list(args) ttl = int(args.pop(0)) if isinstance(args[0], dns.rdata.Rdata): if replace: self.delete(name, args[0].rdtype) for rd in args: self._add_rr(name, ttl, rd, section=section) else: rdtype = args.pop(0) if isinstance(rdtype, string_types): rdtype = dns.rdatatype.from_text(rdtype) if replace: self.delete(name, rdtype) for s in args: rd = dns.rdata.from_text(self.zone_rdclass, rdtype, s, self.origin) self._add_rr(name, ttl, rd, section=section) def add(self, name, *args): """Add records. The first argument is always a name. The other arguments can be: - rdataset... - ttl, rdata... - ttl, rdtype, string...""" self._add(False, self.authority, name, *args) def delete(self, name, *args): """Delete records. The first argument is always a name. The other arguments can be: - I{nothing} - rdataset... - rdata... - rdtype, [string...]""" if isinstance(name, string_types): name = dns.name.from_text(name, None) if len(args) == 0: self.find_rrset(self.authority, name, dns.rdataclass.ANY, dns.rdatatype.ANY, dns.rdatatype.NONE, dns.rdatatype.ANY, True, True) elif isinstance(args[0], dns.rdataset.Rdataset): for rds in args: for rd in rds: self._add_rr(name, 0, rd, dns.rdataclass.NONE) else: args = list(args) if isinstance(args[0], dns.rdata.Rdata): for rd in args: self._add_rr(name, 0, rd, dns.rdataclass.NONE) else: rdtype = args.pop(0) if isinstance(rdtype, string_types): rdtype = dns.rdatatype.from_text(rdtype) if len(args) == 0: self.find_rrset(self.authority, name, self.zone_rdclass, rdtype, dns.rdatatype.NONE, dns.rdataclass.ANY, True, True) else: for s in args: rd = dns.rdata.from_text(self.zone_rdclass, rdtype, s, self.origin) self._add_rr(name, 0, rd, dns.rdataclass.NONE) def replace(self, name, *args): """Replace records. The first argument is always a name. The other arguments can be: - rdataset... - ttl, rdata... - ttl, rdtype, string... Note that if you want to replace the entire node, you should do a delete of the name followed by one or more calls to add.""" self._add(True, self.authority, name, *args) def present(self, name, *args): """Require that an owner name (and optionally an rdata type, or specific rdataset) exists as a prerequisite to the execution of the update. The first argument is always a name. The other arguments can be: - rdataset... - rdata... - rdtype, string...""" if isinstance(name, string_types): name = dns.name.from_text(name, None) if len(args) == 0: self.find_rrset(self.answer, name, dns.rdataclass.ANY, dns.rdatatype.ANY, dns.rdatatype.NONE, None, True, True) elif isinstance(args[0], dns.rdataset.Rdataset) or \ isinstance(args[0], dns.rdata.Rdata) or \ len(args) > 1: if not isinstance(args[0], dns.rdataset.Rdataset): # Add a 0 TTL args = list(args) args.insert(0, 0) self._add(False, self.answer, name, *args) else: rdtype = args[0] if isinstance(rdtype, string_types): rdtype = dns.rdatatype.from_text(rdtype) self.find_rrset(self.answer, name, dns.rdataclass.ANY, rdtype, dns.rdatatype.NONE, None, True, True) def absent(self, name, rdtype=None): """Require that an owner name (and optionally an rdata type) does not exist as a prerequisite to the execution of the update.""" if isinstance(name, string_types): name = dns.name.from_text(name, None) if rdtype is None: self.find_rrset(self.answer, name, dns.rdataclass.NONE, dns.rdatatype.ANY, dns.rdatatype.NONE, None, True, True) else: if isinstance(rdtype, string_types): rdtype = dns.rdatatype.from_text(rdtype) self.find_rrset(self.answer, name, dns.rdataclass.NONE, rdtype, dns.rdatatype.NONE, None, True, True) def to_wire(self, origin=None, max_size=65535): """Return a string containing the update in DNS compressed wire format. @rtype: string""" if origin is None: origin = self.origin return super(Update, self).to_wire(origin, max_size) PK g\7Dr r name.pynu [ # Copyright (C) 2001-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. """DNS Names. @var root: The DNS root name. @type root: dns.name.Name object @var empty: The empty DNS name. @type empty: dns.name.Name object """ from io import BytesIO import struct import sys import copy import encodings.idna try: import idna have_idna_2008 = True except ImportError: have_idna_2008 = False import dns.exception import dns.wiredata from ._compat import long, binary_type, text_type, unichr, maybe_decode try: maxint = sys.maxint except AttributeError: maxint = (1 << (8 * struct.calcsize("P"))) // 2 - 1 NAMERELN_NONE = 0 NAMERELN_SUPERDOMAIN = 1 NAMERELN_SUBDOMAIN = 2 NAMERELN_EQUAL = 3 NAMERELN_COMMONANCESTOR = 4 class EmptyLabel(dns.exception.SyntaxError): """A DNS label is empty.""" class BadEscape(dns.exception.SyntaxError): """An escaped code in a text format of DNS name is invalid.""" class BadPointer(dns.exception.FormError): """A DNS compression pointer points forward instead of backward.""" class BadLabelType(dns.exception.FormError): """The label type in DNS name wire format is unknown.""" class NeedAbsoluteNameOrOrigin(dns.exception.DNSException): """An attempt was made to convert a non-absolute name to wire when there was also a non-absolute (or missing) origin.""" class NameTooLong(dns.exception.FormError): """A DNS name is > 255 octets long.""" class LabelTooLong(dns.exception.SyntaxError): """A DNS label is > 63 octets long.""" class AbsoluteConcatenation(dns.exception.DNSException): """An attempt was made to append anything other than the empty name to an absolute DNS name.""" class NoParent(dns.exception.DNSException): """An attempt was made to get the parent of the root name or the empty name.""" class NoIDNA2008(dns.exception.DNSException): """IDNA 2008 processing was requested but the idna module is not available.""" class IDNAException(dns.exception.DNSException): """IDNA processing raised an exception.""" supp_kwargs = set(['idna_exception']) fmt = "IDNA processing exception: {idna_exception}" class IDNACodec(object): """Abstract base class for IDNA encoder/decoders.""" def __init__(self): pass def is_idna(self, label): return label.lower().startswith(b'xn--') def is_all_ascii(self, label): for c in label: if ord(c) > 0x7f: return False return True def encode(self, label): raise NotImplementedError def decode(self, label): # We do not apply any IDNA policy on decode. if self.is_idna(label): try: label = label[4:].decode('punycode') except Exception as e: raise IDNAException(idna_exception=e) else: label = maybe_decode(label) return _escapify(label) class IDNA2003Codec(IDNACodec): """IDNA 2003 encoder/decoder.""" def __init__(self, strict_decode=False): """Initialize the IDNA 2003 encoder/decoder. @param strict_decode: If True, then IDNA2003 checking is done when decoding. This can cause failures if the name was encoded with IDNA2008. The default is False. @type strict_decode: bool """ super(IDNA2003Codec, self).__init__() self.strict_decode = strict_decode def encode(self, label): if label == '': return b'' try: return encodings.idna.ToASCII(label) except UnicodeError: raise LabelTooLong def decode(self, label): if not self.strict_decode: return super(IDNA2003Codec, self).decode(label) if label == b'': return u'' try: return _escapify(encodings.idna.ToUnicode(label)) except Exception as e: raise IDNAException(idna_exception=e) class IDNA2008Codec(IDNACodec): """IDNA 2008 encoder/decoder.""" def __init__(self, uts_46=False, transitional=False, allow_pure_ascii=False, strict_decode=False): """Initialize the IDNA 2008 encoder/decoder. @param uts_46: If True, apply Unicode IDNA compatibility processing as described in Unicode Technical Standard #46 (U{http://unicode.org/reports/tr46/}). This parameter is only meaningful if IDNA 2008 is in use. If False, do not apply the mapping. The default is False @type uts_46: bool @param transitional: If True, use the "transitional" mode described in Unicode Technical Standard #46. This parameter is only meaningful if IDNA 2008 is in use. The default is False. @type transitional: bool @param allow_pure_ascii: If True, then a label which consists of only ASCII characters is allowed. This is less strict than regular IDNA 2008, but is also necessary for mixed names, e.g. a name with starting with "_sip._tcp." and ending in an IDN suffixm which would otherwise be disallowed. The default is False @type allow_pure_ascii: bool @param strict_decode: If True, then IDNA2008 checking is done when decoding. This can cause failures if the name was encoded with IDNA2003. The default is False. @type strict_decode: bool """ super(IDNA2008Codec, self).__init__() self.uts_46 = uts_46 self.transitional = transitional self.allow_pure_ascii = allow_pure_ascii self.strict_decode = strict_decode def encode(self, label): if label == '': return b'' if self.allow_pure_ascii and self.is_all_ascii(label): return label.encode('ascii') if not have_idna_2008: raise NoIDNA2008 try: if self.uts_46: label = idna.uts46_remap(label, False, self.transitional) return idna.alabel(label) except idna.IDNAError as e: raise IDNAException(idna_exception=e) def decode(self, label): if not self.strict_decode: return super(IDNA2008Codec, self).decode(label) if label == b'': return u'' if not have_idna_2008: raise NoIDNA2008 try: if self.uts_46: label = idna.uts46_remap(label, False, False) return _escapify(idna.ulabel(label)) except idna.IDNAError as e: raise IDNAException(idna_exception=e) _escaped = bytearray(b'"().;\\@$') _escaped_text = '"().;\\@$' IDNA_2003_Practical = IDNA2003Codec(False) IDNA_2003_Strict = IDNA2003Codec(True) IDNA_2003 = IDNA_2003_Practical IDNA_2008_Practical = IDNA2008Codec(True, False, True, False) IDNA_2008_UTS_46 = IDNA2008Codec(True, False, False, False) IDNA_2008_Strict = IDNA2008Codec(False, False, False, True) IDNA_2008_Transitional = IDNA2008Codec(True, True, False, False) IDNA_2008 = IDNA_2008_Practical def _escapify(label): """Escape the characters in label which need it. @returns: the escaped string @rtype: string""" if isinstance(label, bytes): # Ordinary DNS label mode. Escape special characters and values # < 0x20 or > 0x7f. text = '' if isinstance(label, text_type): label = label.encode() for c in bytearray(label): if c in _escaped: text += '\\' + chr(c) elif c > 0x20 and c < 0x7F: text += chr(c) else: text += '\\%03d' % c return text # Unicode label mode. Escape only special characters and values < 0x20 text = u'' for c in label: if c in _escaped_text: text += '\\' + c elif c <= '\x20': text += '\\%03d' % ord(c) else: text += c return text def _validate_labels(labels): """Check for empty labels in the middle of a label sequence, labels that are too long, and for too many labels. @raises NameTooLong: the name as a whole is too long @raises EmptyLabel: a label is empty (i.e. the root label) and appears in a position other than the end of the label sequence""" l = len(labels) total = 0 i = -1 j = 0 for label in labels: ll = len(label) total += ll + 1 if ll > 63: raise LabelTooLong if i < 0 and label == b'': i = j j += 1 if total > 255: raise NameTooLong if i >= 0 and i != l - 1: raise EmptyLabel def _ensure_bytes(label): if isinstance(label, binary_type): return label if isinstance(label, text_type): return label.encode() raise ValueError class Name(object): """A DNS name. The dns.name.Name class represents a DNS name as a tuple of labels. Instances of the class are immutable. @ivar labels: The tuple of labels in the name. Each label is a string of up to 63 octets.""" __slots__ = ['labels'] def __init__(self, labels): """Initialize a domain name from a list of labels. @param labels: the labels @type labels: any iterable whose values are strings """ labels = [_ensure_bytes(x) for x in labels] super(Name, self).__setattr__('labels', tuple(labels)) _validate_labels(self.labels) def __setattr__(self, name, value): raise TypeError("object doesn't support attribute assignment") def __copy__(self): return Name(self.labels) def __deepcopy__(self, memo): return Name(copy.deepcopy(self.labels, memo)) def __getstate__(self): return {'labels': self.labels} def __setstate__(self, state): super(Name, self).__setattr__('labels', state['labels']) _validate_labels(self.labels) def is_absolute(self): """Is the most significant label of this name the root label? @rtype: bool """ return len(self.labels) > 0 and self.labels[-1] == b'' def is_wild(self): """Is this name wild? (I.e. Is the least significant label '*'?) @rtype: bool """ return len(self.labels) > 0 and self.labels[0] == b'*' def __hash__(self): """Return a case-insensitive hash of the name. @rtype: int """ h = long(0) for label in self.labels: for c in bytearray(label.lower()): h += (h << 3) + c return int(h % maxint) def fullcompare(self, other): """Compare two names, returning a 3-tuple (relation, order, nlabels). I{relation} describes the relation ship between the names, and is one of: dns.name.NAMERELN_NONE, dns.name.NAMERELN_SUPERDOMAIN, dns.name.NAMERELN_SUBDOMAIN, dns.name.NAMERELN_EQUAL, or dns.name.NAMERELN_COMMONANCESTOR I{order} is < 0 if self < other, > 0 if self > other, and == 0 if self == other. A relative name is always less than an absolute name. If both names have the same relativity, then the DNSSEC order relation is used to order them. I{nlabels} is the number of significant labels that the two names have in common. """ sabs = self.is_absolute() oabs = other.is_absolute() if sabs != oabs: if sabs: return (NAMERELN_NONE, 1, 0) else: return (NAMERELN_NONE, -1, 0) l1 = len(self.labels) l2 = len(other.labels) ldiff = l1 - l2 if ldiff < 0: l = l1 else: l = l2 order = 0 nlabels = 0 namereln = NAMERELN_NONE while l > 0: l -= 1 l1 -= 1 l2 -= 1 label1 = self.labels[l1].lower() label2 = other.labels[l2].lower() if label1 < label2: order = -1 if nlabels > 0: namereln = NAMERELN_COMMONANCESTOR return (namereln, order, nlabels) elif label1 > label2: order = 1 if nlabels > 0: namereln = NAMERELN_COMMONANCESTOR return (namereln, order, nlabels) nlabels += 1 order = ldiff if ldiff < 0: namereln = NAMERELN_SUPERDOMAIN elif ldiff > 0: namereln = NAMERELN_SUBDOMAIN else: namereln = NAMERELN_EQUAL return (namereln, order, nlabels) def is_subdomain(self, other): """Is self a subdomain of other? The notion of subdomain includes equality. @rtype: bool """ (nr, o, nl) = self.fullcompare(other) if nr == NAMERELN_SUBDOMAIN or nr == NAMERELN_EQUAL: return True return False def is_superdomain(self, other): """Is self a superdomain of other? The notion of subdomain includes equality. @rtype: bool """ (nr, o, nl) = self.fullcompare(other) if nr == NAMERELN_SUPERDOMAIN or nr == NAMERELN_EQUAL: return True return False def canonicalize(self): """Return a name which is equal to the current name, but is in DNSSEC canonical form. @rtype: dns.name.Name object """ return Name([x.lower() for x in self.labels]) def __eq__(self, other): if isinstance(other, Name): return self.fullcompare(other)[1] == 0 else: return False def __ne__(self, other): if isinstance(other, Name): return self.fullcompare(other)[1] != 0 else: return True def __lt__(self, other): if isinstance(other, Name): return self.fullcompare(other)[1] < 0 else: return NotImplemented def __le__(self, other): if isinstance(other, Name): return self.fullcompare(other)[1] <= 0 else: return NotImplemented def __ge__(self, other): if isinstance(other, Name): return self.fullcompare(other)[1] >= 0 else: return NotImplemented def __gt__(self, other): if isinstance(other, Name): return self.fullcompare(other)[1] > 0 else: return NotImplemented def __repr__(self): return '<DNS name ' + self.__str__() + '>' def __str__(self): return self.to_text(False) def to_text(self, omit_final_dot=False): """Convert name to text format. @param omit_final_dot: If True, don't emit the final dot (denoting the root label) for absolute names. The default is False. @rtype: string """ if len(self.labels) == 0: return maybe_decode(b'@') if len(self.labels) == 1 and self.labels[0] == b'': return maybe_decode(b'.') if omit_final_dot and self.is_absolute(): l = self.labels[:-1] else: l = self.labels s = '.'.join(map(_escapify, l)) return s def to_unicode(self, omit_final_dot=False, idna_codec=None): """Convert name to Unicode text format. IDN ACE labels are converted to Unicode. @param omit_final_dot: If True, don't emit the final dot (denoting the root label) for absolute names. The default is False. @type omit_final_dot: bool @param idna_codec: IDNA encoder/decoder. If None, the IDNA_2003_Practical encoder/decoder is used. The IDNA_2003_Practical decoder does not impose any policy, it just decodes punycode, so if you don't want checking for compliance, you can use this decoder for IDNA2008 as well. @type idna_codec: dns.name.IDNA @rtype: string """ if len(self.labels) == 0: return u'@' if len(self.labels) == 1 and self.labels[0] == b'': return u'.' if omit_final_dot and self.is_absolute(): l = self.labels[:-1] else: l = self.labels if idna_codec is None: idna_codec = IDNA_2003_Practical return u'.'.join([idna_codec.decode(x) for x in l]) def to_digestable(self, origin=None): """Convert name to a format suitable for digesting in hashes. The name is canonicalized and converted to uncompressed wire format. @param origin: If the name is relative and origin is not None, then origin will be appended to it. @type origin: dns.name.Name object @raises NeedAbsoluteNameOrOrigin: All names in wire format are absolute. If self is a relative name, then an origin must be supplied; if it is missing, then this exception is raised @rtype: string """ if not self.is_absolute(): if origin is None or not origin.is_absolute(): raise NeedAbsoluteNameOrOrigin labels = list(self.labels) labels.extend(list(origin.labels)) else: labels = self.labels dlabels = [struct.pack('!B%ds' % len(x), len(x), x.lower()) for x in labels] return b''.join(dlabels) def to_wire(self, file=None, compress=None, origin=None): """Convert name to wire format, possibly compressing it. @param file: the file where the name is emitted (typically a BytesIO file). If None, a string containing the wire name will be returned. @type file: file or None @param compress: The compression table. If None (the default) names will not be compressed. @type compress: dict @param origin: If the name is relative and origin is not None, then origin will be appended to it. @type origin: dns.name.Name object @raises NeedAbsoluteNameOrOrigin: All names in wire format are absolute. If self is a relative name, then an origin must be supplied; if it is missing, then this exception is raised """ if file is None: file = BytesIO() want_return = True else: want_return = False if not self.is_absolute(): if origin is None or not origin.is_absolute(): raise NeedAbsoluteNameOrOrigin labels = list(self.labels) labels.extend(list(origin.labels)) else: labels = self.labels i = 0 for label in labels: n = Name(labels[i:]) i += 1 if compress is not None: pos = compress.get(n) else: pos = None if pos is not None: value = 0xc000 + pos s = struct.pack('!H', value) file.write(s) break else: if compress is not None and len(n) > 1: pos = file.tell() if pos <= 0x3fff: compress[n] = pos l = len(label) file.write(struct.pack('!B', l)) if l > 0: file.write(label) if want_return: return file.getvalue() def __len__(self): """The length of the name (in labels). @rtype: int """ return len(self.labels) def __getitem__(self, index): return self.labels[index] def __add__(self, other): return self.concatenate(other) def __sub__(self, other): return self.relativize(other) def split(self, depth): """Split a name into a prefix and suffix at depth. @param depth: the number of labels in the suffix @type depth: int @raises ValueError: the depth was not >= 0 and <= the length of the name. @returns: the tuple (prefix, suffix) @rtype: tuple """ l = len(self.labels) if depth == 0: return (self, dns.name.empty) elif depth == l: return (dns.name.empty, self) elif depth < 0 or depth > l: raise ValueError( 'depth must be >= 0 and <= the length of the name') return (Name(self[: -depth]), Name(self[-depth:])) def concatenate(self, other): """Return a new name which is the concatenation of self and other. @rtype: dns.name.Name object @raises AbsoluteConcatenation: self is absolute and other is not the empty name """ if self.is_absolute() and len(other) > 0: raise AbsoluteConcatenation labels = list(self.labels) labels.extend(list(other.labels)) return Name(labels) def relativize(self, origin): """If self is a subdomain of origin, return a new name which is self relative to origin. Otherwise return self. @rtype: dns.name.Name object """ if origin is not None and self.is_subdomain(origin): return Name(self[: -len(origin)]) else: return self def derelativize(self, origin): """If self is a relative name, return a new name which is the concatenation of self and origin. Otherwise return self. @rtype: dns.name.Name object """ if not self.is_absolute(): return self.concatenate(origin) else: return self def choose_relativity(self, origin=None, relativize=True): """Return a name with the relativity desired by the caller. If origin is None, then self is returned. Otherwise, if relativize is true the name is relativized, and if relativize is false the name is derelativized. @rtype: dns.name.Name object """ if origin: if relativize: return self.relativize(origin) else: return self.derelativize(origin) else: return self def parent(self): """Return the parent of the name. @rtype: dns.name.Name object @raises NoParent: the name is either the root name or the empty name, and thus has no parent. """ if self == root or self == empty: raise NoParent return Name(self.labels[1:]) root = Name([b'']) empty = Name([]) def from_unicode(text, origin=root, idna_codec=None): """Convert unicode text into a Name object. Labels are encoded in IDN ACE form. @param text: The text to convert into a name. @type text: Unicode string @param origin: The origin to append to non-absolute names. @type origin: dns.name.Name @param idna_codec: IDNA encoder/decoder. If None, the default IDNA 2003 encoder/decoder is used. @type idna_codec: dns.name.IDNA @rtype: dns.name.Name object """ if not isinstance(text, text_type): raise ValueError("input to from_unicode() must be a unicode string") if not (origin is None or isinstance(origin, Name)): raise ValueError("origin must be a Name or None") labels = [] label = u'' escaping = False edigits = 0 total = 0 if idna_codec is None: idna_codec = IDNA_2003 if text == u'@': text = u'' if text: if text == u'.': return Name([b'']) # no Unicode "u" on this constant! for c in text: if escaping: if edigits == 0: if c.isdigit(): total = int(c) edigits += 1 else: label += c escaping = False else: if not c.isdigit(): raise BadEscape total *= 10 total += int(c) edigits += 1 if edigits == 3: escaping = False label += unichr(total) elif c in [u'.', u'\u3002', u'\uff0e', u'\uff61']: if len(label) == 0: raise EmptyLabel labels.append(idna_codec.encode(label)) label = u'' elif c == u'\\': escaping = True edigits = 0 total = 0 else: label += c if escaping: raise BadEscape if len(label) > 0: labels.append(idna_codec.encode(label)) else: labels.append(b'') if (len(labels) == 0 or labels[-1] != b'') and origin is not None: labels.extend(list(origin.labels)) return Name(labels) def from_text(text, origin=root, idna_codec=None): """Convert text into a Name object. @param text: The text to convert into a name. @type text: string @param origin: The origin to append to non-absolute names. @type origin: dns.name.Name @param idna_codec: IDNA encoder/decoder. If None, the default IDNA 2003 encoder/decoder is used. @type idna_codec: dns.name.IDNA @rtype: dns.name.Name object """ if isinstance(text, text_type): return from_unicode(text, origin, idna_codec) if not isinstance(text, binary_type): raise ValueError("input to from_text() must be a string") if not (origin is None or isinstance(origin, Name)): raise ValueError("origin must be a Name or None") labels = [] label = b'' escaping = False edigits = 0 total = 0 if text == b'@': text = b'' if text: if text == b'.': return Name([b'']) for c in bytearray(text): byte_ = struct.pack('!B', c) if escaping: if edigits == 0: if byte_.isdigit(): total = int(byte_) edigits += 1 else: label += byte_ escaping = False else: if not byte_.isdigit(): raise BadEscape total *= 10 total += int(byte_) edigits += 1 if edigits == 3: escaping = False label += struct.pack('!B', total) elif byte_ == b'.': if len(label) == 0: raise EmptyLabel labels.append(label) label = b'' elif byte_ == b'\\': escaping = True edigits = 0 total = 0 else: label += byte_ if escaping: raise BadEscape if len(label) > 0: labels.append(label) else: labels.append(b'') if (len(labels) == 0 or labels[-1] != b'') and origin is not None: labels.extend(list(origin.labels)) return Name(labels) def from_wire(message, current): """Convert possibly compressed wire format into a Name. @param message: the entire DNS message @type message: string @param current: the offset of the beginning of the name from the start of the message @type current: int @raises dns.name.BadPointer: a compression pointer did not point backwards in the message @raises dns.name.BadLabelType: an invalid label type was encountered. @returns: a tuple consisting of the name that was read and the number of bytes of the wire format message which were consumed reading it @rtype: (dns.name.Name object, int) tuple """ if not isinstance(message, binary_type): raise ValueError("input to from_wire() must be a byte string") message = dns.wiredata.maybe_wrap(message) labels = [] biggest_pointer = current hops = 0 count = message[current] current += 1 cused = 1 while count != 0: if count < 64: labels.append(message[current: current + count].unwrap()) current += count if hops == 0: cused += count elif count >= 192: current = (count & 0x3f) * 256 + message[current] if hops == 0: cused += 1 if current >= biggest_pointer: raise BadPointer biggest_pointer = current hops += 1 else: raise BadLabelType count = message[current] current += 1 if hops == 0: cused += 1 labels.append('') return (Name(labels), cused) PK g\ų4h h flags.pynu [ # Copyright (C) 2001-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. """DNS Message Flags.""" # Standard DNS flags QR = 0x8000 AA = 0x0400 TC = 0x0200 RD = 0x0100 RA = 0x0080 AD = 0x0020 CD = 0x0010 # EDNS flags DO = 0x8000 _by_text = { 'QR': QR, 'AA': AA, 'TC': TC, 'RD': RD, 'RA': RA, 'AD': AD, 'CD': CD } _edns_by_text = { 'DO': DO } # We construct the inverse mappings programmatically to ensure that we # cannot make any mistakes (e.g. omissions, cut-and-paste errors) that # would cause the mappings not to be true inverses. _by_value = dict((y, x) for x, y in _by_text.items()) _edns_by_value = dict((y, x) for x, y in _edns_by_text.items()) def _order_flags(table): order = list(table.items()) order.sort() order.reverse() return order _flags_order = _order_flags(_by_value) _edns_flags_order = _order_flags(_edns_by_value) def _from_text(text, table): flags = 0 tokens = text.split() for t in tokens: flags = flags | table[t.upper()] return flags def _to_text(flags, table, order): text_flags = [] for k, v in order: if flags & k != 0: text_flags.append(v) return ' '.join(text_flags) def from_text(text): """Convert a space-separated list of flag text values into a flags value. @rtype: int""" return _from_text(text, _by_text) def to_text(flags): """Convert a flags value into a space-separated list of flag text values. @rtype: string""" return _to_text(flags, _by_value, _flags_order) def edns_from_text(text): """Convert a space-separated list of EDNS flag text values into a EDNS flags value. @rtype: int""" return _from_text(text, _edns_by_text) def edns_to_text(flags): """Convert an EDNS flags value into a space-separated list of EDNS flag text values. @rtype: string""" return _to_text(flags, _edns_by_value, _edns_flags_order) PK g\25 # # set.pynu [ # Copyright (C) 2003-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. """A simple Set class.""" class Set(object): """A simple set class. Sets are not in Python until 2.3, and rdata are not immutable so we cannot use sets.Set anyway. This class implements subset of the 2.3 Set interface using a list as the container. @ivar items: A list of the items which are in the set @type items: list""" __slots__ = ['items'] def __init__(self, items=None): """Initialize the set. @param items: the initial set of items @type items: any iterable or None """ self.items = [] if items is not None: for item in items: self.add(item) def __repr__(self): return "dns.simpleset.Set(%s)" % repr(self.items) def add(self, item): """Add an item to the set.""" if item not in self.items: self.items.append(item) def remove(self, item): """Remove an item from the set.""" self.items.remove(item) def discard(self, item): """Remove an item from the set if present.""" try: self.items.remove(item) except ValueError: pass def _clone(self): """Make a (shallow) copy of the set. There is a 'clone protocol' that subclasses of this class should use. To make a copy, first call your super's _clone() method, and use the object returned as the new instance. Then make shallow copies of the attributes defined in the subclass. This protocol allows us to write the set algorithms that return new instances (e.g. union) once, and keep using them in subclasses. """ cls = self.__class__ obj = cls.__new__(cls) obj.items = list(self.items) return obj def __copy__(self): """Make a (shallow) copy of the set.""" return self._clone() def copy(self): """Make a (shallow) copy of the set.""" return self._clone() def union_update(self, other): """Update the set, adding any elements from other which are not already in the set. @param other: the collection of items with which to update the set @type other: Set object """ if not isinstance(other, Set): raise ValueError('other must be a Set instance') if self is other: return for item in other.items: self.add(item) def intersection_update(self, other): """Update the set, removing any elements from other which are not in both sets. @param other: the collection of items with which to update the set @type other: Set object """ if not isinstance(other, Set): raise ValueError('other must be a Set instance') if self is other: return # we make a copy of the list so that we can remove items from # the list without breaking the iterator. for item in list(self.items): if item not in other.items: self.items.remove(item) def difference_update(self, other): """Update the set, removing any elements from other which are in the set. @param other: the collection of items with which to update the set @type other: Set object """ if not isinstance(other, Set): raise ValueError('other must be a Set instance') if self is other: self.items = [] else: for item in other.items: self.discard(item) def union(self, other): """Return a new set which is the union of I{self} and I{other}. @param other: the other set @type other: Set object @rtype: the same type as I{self} """ obj = self._clone() obj.union_update(other) return obj def intersection(self, other): """Return a new set which is the intersection of I{self} and I{other}. @param other: the other set @type other: Set object @rtype: the same type as I{self} """ obj = self._clone() obj.intersection_update(other) return obj def difference(self, other): """Return a new set which I{self} - I{other}, i.e. the items in I{self} which are not also in I{other}. @param other: the other set @type other: Set object @rtype: the same type as I{self} """ obj = self._clone() obj.difference_update(other) return obj def __or__(self, other): return self.union(other) def __and__(self, other): return self.intersection(other) def __add__(self, other): return self.union(other) def __sub__(self, other): return self.difference(other) def __ior__(self, other): self.union_update(other) return self def __iand__(self, other): self.intersection_update(other) return self def __iadd__(self, other): self.union_update(other) return self def __isub__(self, other): self.difference_update(other) return self def update(self, other): """Update the set, adding any elements from other which are not already in the set. @param other: the collection of items with which to update the set @type other: any iterable type""" for item in other: self.add(item) def clear(self): """Make the set empty.""" self.items = [] def __eq__(self, other): # Yes, this is inefficient but the sets we're dealing with are # usually quite small, so it shouldn't hurt too much. for item in self.items: if item not in other.items: return False for item in other.items: if item not in self.items: return False return True def __ne__(self, other): return not self.__eq__(other) def __len__(self): return len(self.items) def __iter__(self): return iter(self.items) def __getitem__(self, i): return self.items[i] def __delitem__(self, i): del self.items[i] def issubset(self, other): """Is I{self} a subset of I{other}? @rtype: bool """ if not isinstance(other, Set): raise ValueError('other must be a Set instance') for item in self.items: if item not in other.items: return False return True def issuperset(self, other): """Is I{self} a superset of I{other}? @rtype: bool """ if not isinstance(other, Set): raise ValueError('other must be a Set instance') for item in other.items: if item not in self.items: return False return True PK g\Cyx edns.pynu [ # Copyright (C) 2009, 2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. """EDNS Options""" NSID = 3 class Option(object): """Base class for all EDNS option types. """ def __init__(self, otype): """Initialize an option. @param otype: The rdata type @type otype: int """ self.otype = otype def to_wire(self, file): """Convert an option to wire format. """ raise NotImplementedError @classmethod def from_wire(cls, otype, wire, current, olen): """Build an EDNS option object from wire format @param otype: The option type @type otype: int @param wire: The wire-format message @type wire: string @param current: The offset in wire of the beginning of the rdata. @type current: int @param olen: The length of the wire-format option data @type olen: int @rtype: dns.edns.Option instance""" raise NotImplementedError def _cmp(self, other): """Compare an EDNS option with another option of the same type. Return < 0 if self < other, 0 if self == other, and > 0 if self > other. """ raise NotImplementedError def __eq__(self, other): if not isinstance(other, Option): return False if self.otype != other.otype: return False return self._cmp(other) == 0 def __ne__(self, other): if not isinstance(other, Option): return False if self.otype != other.otype: return False return self._cmp(other) != 0 def __lt__(self, other): if not isinstance(other, Option) or \ self.otype != other.otype: return NotImplemented return self._cmp(other) < 0 def __le__(self, other): if not isinstance(other, Option) or \ self.otype != other.otype: return NotImplemented return self._cmp(other) <= 0 def __ge__(self, other): if not isinstance(other, Option) or \ self.otype != other.otype: return NotImplemented return self._cmp(other) >= 0 def __gt__(self, other): if not isinstance(other, Option) or \ self.otype != other.otype: return NotImplemented return self._cmp(other) > 0 class GenericOption(Option): """Generate Rdata Class This class is used for EDNS option types for which we have no better implementation. """ def __init__(self, otype, data): super(GenericOption, self).__init__(otype) self.data = data def to_wire(self, file): file.write(self.data) @classmethod def from_wire(cls, otype, wire, current, olen): return cls(otype, wire[current: current + olen]) def _cmp(self, other): if self.data == other.data: return 0 if self.data > other.data: return 1 return -1 _type_to_class = { } def get_option_class(otype): cls = _type_to_class.get(otype) if cls is None: cls = GenericOption return cls def option_from_wire(otype, wire, current, olen): """Build an EDNS option object from wire format @param otype: The option type @type otype: int @param wire: The wire-format message @type wire: string @param current: The offset in wire of the beginning of the rdata. @type current: int @param olen: The length of the wire-format option data @type olen: int @rtype: dns.edns.Option instance""" cls = get_option_class(otype) return cls.from_wire(otype, wire, current, olen) PK g\O ttl.pynu [ # Copyright (C) 2003-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. """DNS TTL conversion.""" import dns.exception from ._compat import long class BadTTL(dns.exception.SyntaxError): """DNS TTL value is not well-formed.""" def from_text(text): """Convert the text form of a TTL to an integer. The BIND 8 units syntax for TTLs (e.g. '1w6d4h3m10s') is supported. @param text: the textual TTL @type text: string @raises dns.ttl.BadTTL: the TTL is not well-formed @rtype: int """ if text.isdigit(): total = long(text) else: if not text[0].isdigit(): raise BadTTL total = long(0) current = long(0) for c in text: if c.isdigit(): current *= 10 current += long(c) else: c = c.lower() if c == 'w': total += current * long(604800) elif c == 'd': total += current * long(86400) elif c == 'h': total += current * long(3600) elif c == 'm': total += current * long(60) elif c == 's': total += current else: raise BadTTL("unknown unit '%s'" % c) current = 0 if not current == 0: raise BadTTL("trailing integer") if total < long(0) or total > long(2147483647): raise BadTTL("TTL should be between 0 and 2^31 - 1 (inclusive)") return total PK g\;J rdtypes/IN/NSAP.pynu [ # Copyright (C) 2003-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. import binascii import dns.exception import dns.rdata import dns.tokenizer class NSAP(dns.rdata.Rdata): """NSAP record. @ivar address: a NASP @type address: string @see: RFC 1706""" __slots__ = ['address'] def __init__(self, rdclass, rdtype, address): super(NSAP, self).__init__(rdclass, rdtype) self.address = address def to_text(self, origin=None, relativize=True, **kw): return "0x%s" % binascii.hexlify(self.address).decode() @classmethod def from_text(cls, rdclass, rdtype, tok, origin=None, relativize=True): address = tok.get_string() tok.get_eol() if address[0:2] != '0x': raise dns.exception.SyntaxError('string does not start with 0x') address = address[2:].replace('.', '') if len(address) % 2 != 0: raise dns.exception.SyntaxError('hexstring has odd length') address = binascii.unhexlify(address.encode()) return cls(rdclass, rdtype, address) def to_wire(self, file, compress=None, origin=None): file.write(self.address) @classmethod def from_wire(cls, rdclass, rdtype, wire, current, rdlen, origin=None): address = wire[current: current + rdlen].unwrap() return cls(rdclass, rdtype, address) PK g\/"t t rdtypes/IN/APL.pynu [ # Copyright (C) 2003-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. import struct import binascii import dns.exception import dns.inet import dns.rdata import dns.tokenizer from dns._compat import xrange class APLItem(object): """An APL list item. @ivar family: the address family (IANA address family registry) @type family: int @ivar negation: is this item negated? @type negation: bool @ivar address: the address @type address: string @ivar prefix: the prefix length @type prefix: int """ __slots__ = ['family', 'negation', 'address', 'prefix'] def __init__(self, family, negation, address, prefix): self.family = family self.negation = negation self.address = address self.prefix = prefix def __str__(self): if self.negation: return "!%d:%s/%s" % (self.family, self.address, self.prefix) else: return "%d:%s/%s" % (self.family, self.address, self.prefix) def to_wire(self, file): if self.family == 1: address = dns.inet.inet_pton(dns.inet.AF_INET, self.address) elif self.family == 2: address = dns.inet.inet_pton(dns.inet.AF_INET6, self.address) else: address = binascii.unhexlify(self.address) # # Truncate least significant zero bytes. # last = 0 for i in xrange(len(address) - 1, -1, -1): if address[i] != chr(0): last = i + 1 break address = address[0: last] l = len(address) assert l < 128 if self.negation: l |= 0x80 header = struct.pack('!HBB', self.family, self.prefix, l) file.write(header) file.write(address) class APL(dns.rdata.Rdata): """APL record. @ivar items: a list of APL items @type items: list of APL_Item @see: RFC 3123""" __slots__ = ['items'] def __init__(self, rdclass, rdtype, items): super(APL, self).__init__(rdclass, rdtype) self.items = items def to_text(self, origin=None, relativize=True, **kw): return ' '.join(map(str, self.items)) @classmethod def from_text(cls, rdclass, rdtype, tok, origin=None, relativize=True): items = [] while 1: token = tok.get().unescape() if token.is_eol_or_eof(): break item = token.value if item[0] == '!': negation = True item = item[1:] else: negation = False (family, rest) = item.split(':', 1) family = int(family) (address, prefix) = rest.split('/', 1) prefix = int(prefix) item = APLItem(family, negation, address, prefix) items.append(item) return cls(rdclass, rdtype, items) def to_wire(self, file, compress=None, origin=None): for item in self.items: item.to_wire(file) @classmethod def from_wire(cls, rdclass, rdtype, wire, current, rdlen, origin=None): items = [] while 1: if rdlen == 0: break if rdlen < 4: raise dns.exception.FormError header = struct.unpack('!HBB', wire[current: current + 4]) afdlen = header[2] if afdlen > 127: negation = True afdlen -= 128 else: negation = False current += 4 rdlen -= 4 if rdlen < afdlen: raise dns.exception.FormError address = wire[current: current + afdlen].unwrap() l = len(address) if header[0] == 1: if l < 4: address += '\x00' * (4 - l) address = dns.inet.inet_ntop(dns.inet.AF_INET, address) elif header[0] == 2: if l < 16: address += '\x00' * (16 - l) address = dns.inet.inet_ntop(dns.inet.AF_INET6, address) else: # # This isn't really right according to the RFC, but it # seems better than throwing an exception # address = address.encode('hex_codec') current += afdlen rdlen -= afdlen item = APLItem(header[0], negation, address, header[1]) items.append(item) return cls(rdclass, rdtype, items) PK g\0 } } rdtypes/IN/NSAP_PTR.pynu [ # Copyright (C) 2003-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. import dns.rdtypes.nsbase class NSAP_PTR(dns.rdtypes.nsbase.UncompressedNS): """NSAP-PTR record""" PK g\21 1 rdtypes/IN/IPSECKEY.pynu [ # Copyright (C) 2006, 2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. import struct import base64 import dns.exception import dns.inet import dns.name class IPSECKEY(dns.rdata.Rdata): """IPSECKEY record @ivar precedence: the precedence for this key data @type precedence: int @ivar gateway_type: the gateway type @type gateway_type: int @ivar algorithm: the algorithm to use @type algorithm: int @ivar gateway: the public key @type gateway: None, IPv4 address, IPV6 address, or domain name @ivar key: the public key @type key: string @see: RFC 4025""" __slots__ = ['precedence', 'gateway_type', 'algorithm', 'gateway', 'key'] def __init__(self, rdclass, rdtype, precedence, gateway_type, algorithm, gateway, key): super(IPSECKEY, self).__init__(rdclass, rdtype) if gateway_type == 0: if gateway != '.' and gateway is not None: raise SyntaxError('invalid gateway for gateway type 0') gateway = None elif gateway_type == 1: # check that it's OK dns.inet.inet_pton(dns.inet.AF_INET, gateway) elif gateway_type == 2: # check that it's OK dns.inet.inet_pton(dns.inet.AF_INET6, gateway) elif gateway_type == 3: pass else: raise SyntaxError( 'invalid IPSECKEY gateway type: %d' % gateway_type) self.precedence = precedence self.gateway_type = gateway_type self.algorithm = algorithm self.gateway = gateway self.key = key def to_text(self, origin=None, relativize=True, **kw): if self.gateway_type == 0: gateway = '.' elif self.gateway_type == 1: gateway = self.gateway elif self.gateway_type == 2: gateway = self.gateway elif self.gateway_type == 3: gateway = str(self.gateway.choose_relativity(origin, relativize)) else: raise ValueError('invalid gateway type') return '%d %d %d %s %s' % (self.precedence, self.gateway_type, self.algorithm, gateway, dns.rdata._base64ify(self.key)) @classmethod def from_text(cls, rdclass, rdtype, tok, origin=None, relativize=True): precedence = tok.get_uint8() gateway_type = tok.get_uint8() algorithm = tok.get_uint8() if gateway_type == 3: gateway = tok.get_name().choose_relativity(origin, relativize) else: gateway = tok.get_string() chunks = [] while 1: t = tok.get().unescape() if t.is_eol_or_eof(): break if not t.is_identifier(): raise dns.exception.SyntaxError chunks.append(t.value.encode()) b64 = b''.join(chunks) key = base64.b64decode(b64) return cls(rdclass, rdtype, precedence, gateway_type, algorithm, gateway, key) def to_wire(self, file, compress=None, origin=None): header = struct.pack("!BBB", self.precedence, self.gateway_type, self.algorithm) file.write(header) if self.gateway_type == 0: pass elif self.gateway_type == 1: file.write(dns.inet.inet_pton(dns.inet.AF_INET, self.gateway)) elif self.gateway_type == 2: file.write(dns.inet.inet_pton(dns.inet.AF_INET6, self.gateway)) elif self.gateway_type == 3: self.gateway.to_wire(file, None, origin) else: raise ValueError('invalid gateway type') file.write(self.key) @classmethod def from_wire(cls, rdclass, rdtype, wire, current, rdlen, origin=None): if rdlen < 3: raise dns.exception.FormError header = struct.unpack('!BBB', wire[current: current + 3]) gateway_type = header[1] current += 3 rdlen -= 3 if gateway_type == 0: gateway = None elif gateway_type == 1: gateway = dns.inet.inet_ntop(dns.inet.AF_INET, wire[current: current + 4]) current += 4 rdlen -= 4 elif gateway_type == 2: gateway = dns.inet.inet_ntop(dns.inet.AF_INET6, wire[current: current + 16]) current += 16 rdlen -= 16 elif gateway_type == 3: (gateway, cused) = dns.name.from_wire(wire[: current + rdlen], current) current += cused rdlen -= cused else: raise dns.exception.FormError('invalid IPSECKEY gateway type') key = wire[current: current + rdlen].unwrap() return cls(rdclass, rdtype, header[0], gateway_type, header[2], gateway, key) PK g\2 rdtypes/IN/SRV.pynu [ # Copyright (C) 2003-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. import struct import dns.exception import dns.rdata import dns.name class SRV(dns.rdata.Rdata): """SRV record @ivar priority: the priority @type priority: int @ivar weight: the weight @type weight: int @ivar port: the port of the service @type port: int @ivar target: the target host @type target: dns.name.Name object @see: RFC 2782""" __slots__ = ['priority', 'weight', 'port', 'target'] def __init__(self, rdclass, rdtype, priority, weight, port, target): super(SRV, self).__init__(rdclass, rdtype) self.priority = priority self.weight = weight self.port = port self.target = target def to_text(self, origin=None, relativize=True, **kw): target = self.target.choose_relativity(origin, relativize) return '%d %d %d %s' % (self.priority, self.weight, self.port, target) @classmethod def from_text(cls, rdclass, rdtype, tok, origin=None, relativize=True): priority = tok.get_uint16() weight = tok.get_uint16() port = tok.get_uint16() target = tok.get_name(None) target = target.choose_relativity(origin, relativize) tok.get_eol() return cls(rdclass, rdtype, priority, weight, port, target) def to_wire(self, file, compress=None, origin=None): three_ints = struct.pack("!HHH", self.priority, self.weight, self.port) file.write(three_ints) self.target.to_wire(file, compress, origin) @classmethod def from_wire(cls, rdclass, rdtype, wire, current, rdlen, origin=None): (priority, weight, port) = struct.unpack('!HHH', wire[current: current + 6]) current += 6 rdlen -= 6 (target, cused) = dns.name.from_wire(wire[: current + rdlen], current) if cused != rdlen: raise dns.exception.FormError if origin is not None: target = target.relativize(origin) return cls(rdclass, rdtype, priority, weight, port, target) def choose_relativity(self, origin=None, relativize=True): self.target = self.target.choose_relativity(origin, relativize) PK g\ qQ rdtypes/IN/WKS.pynu [ # Copyright (C) 2003-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. import socket import struct import dns.ipv4 import dns.rdata from dns._compat import xrange _proto_tcp = socket.getprotobyname('tcp') _proto_udp = socket.getprotobyname('udp') class WKS(dns.rdata.Rdata): """WKS record @ivar address: the address @type address: string @ivar protocol: the protocol @type protocol: int @ivar bitmap: the bitmap @type bitmap: string @see: RFC 1035""" __slots__ = ['address', 'protocol', 'bitmap'] def __init__(self, rdclass, rdtype, address, protocol, bitmap): super(WKS, self).__init__(rdclass, rdtype) self.address = address self.protocol = protocol if not isinstance(bitmap, bytearray): self.bitmap = bytearray(bitmap) else: self.bitmap = bitmap def to_text(self, origin=None, relativize=True, **kw): bits = [] for i in xrange(0, len(self.bitmap)): byte = self.bitmap[i] for j in xrange(0, 8): if byte & (0x80 >> j): bits.append(str(i * 8 + j)) text = ' '.join(bits) return '%s %d %s' % (self.address, self.protocol, text) @classmethod def from_text(cls, rdclass, rdtype, tok, origin=None, relativize=True): address = tok.get_string() protocol = tok.get_string() if protocol.isdigit(): protocol = int(protocol) else: protocol = socket.getprotobyname(protocol) bitmap = bytearray() while 1: token = tok.get().unescape() if token.is_eol_or_eof(): break if token.value.isdigit(): serv = int(token.value) else: if protocol != _proto_udp and protocol != _proto_tcp: raise NotImplementedError("protocol must be TCP or UDP") if protocol == _proto_udp: protocol_text = "udp" else: protocol_text = "tcp" serv = socket.getservbyname(token.value, protocol_text) i = serv // 8 l = len(bitmap) if l < i + 1: for j in xrange(l, i + 1): bitmap.append(0) bitmap[i] = bitmap[i] | (0x80 >> (serv % 8)) bitmap = dns.rdata._truncate_bitmap(bitmap) return cls(rdclass, rdtype, address, protocol, bitmap) def to_wire(self, file, compress=None, origin=None): file.write(dns.ipv4.inet_aton(self.address)) protocol = struct.pack('!B', self.protocol) file.write(protocol) file.write(self.bitmap) @classmethod def from_wire(cls, rdclass, rdtype, wire, current, rdlen, origin=None): address = dns.ipv4.inet_ntoa(wire[current: current + 4]) protocol, = struct.unpack('!B', wire[current + 4: current + 5]) current += 5 rdlen -= 5 bitmap = wire[current: current + rdlen].unwrap() return cls(rdclass, rdtype, address, protocol, bitmap) PK g\ / rdtypes/IN/__pycache__/SRV.cpython-36.opt-1.pycnu [ 3 bW @ s8 d dl Z d dlZd dlZd dlZG dd dejjZdS ) Nc sf e Zd ZdZddddgZ fddZdd d Zedd d ZdddZ edddZ dddZ Z S )SRVa SRV record @ivar priority: the priority @type priority: int @ivar weight: the weight @type weight: int @ivar port: the port of the service @type port: int @ivar target: the target host @type target: dns.name.Name object @see: RFC 2782priorityweightporttargetc s. t t| j|| || _|| _|| _|| _d S )N)superr __init__r r r r )selfrdclassrdtyper r r r ) __class__ /usr/lib/python3.6/SRV.pyr ' s z SRV.__init__NTc K s$ | j j||}d| j| j| j|f S )Nz %d %d %d %s)r choose_relativityr r r )r origin relativizekwr r r r to_text. s z SRV.to_textc C sH |j }|j }|j }|jd } | j||} |j | |||||| S )N)Z get_uint16Zget_namer Zget_eol) clsr r tokr r r r r r r r r from_text3 s z SRV.from_textc C s4 t jd| j| j| j}|j| | jj||| d S )Nz!HHH)structpackr r r writer to_wire)r filecompressr Z three_intsr r r r = s z SRV.to_wirec C s t jd|||d \}}} |d7 }|d8 }tjj|d || |\} } | |kr\tjj|d k rn| j|} | ||||| | S )Nz!HHH )r unpackdnsname from_wireZ exceptionZ FormErrorr ) r r r ZwireZcurrentZrdlenr r r r r Zcusedr r r r! B s z SRV.from_wirec C s | j j||| _ d S )N)r r )r r r r r r r P s zSRV.choose_relativity)NT)NT)NN)N)NT) __name__ __module__ __qualname____doc__ __slots__r r classmethodr r r! r __classcell__r r )r r r s r )r Z dns.exceptionr Z dns.rdataZdns.nameZrdataZRdatar r r r r <module> s PK g\= 1 rdtypes/IN/__pycache__/DHCID.cpython-36.opt-1.pycnu [ 3 bW @ s( d dl Z d dlZG dd dejjZdS ) Nc sV e Zd ZdZdgZ fddZdddZedd d Zdd d Z edd dZ Z S )DHCIDzDHCID record @ivar data: the data (the content of the RR is opaque as far as the DNS is concerned) @type data: string @see: RFC 4701datac s t t| j|| || _d S )N)superr __init__r )selfrdclassrdtyper ) __class__ /usr/lib/python3.6/DHCID.pyr s zDHCID.__init__NTc K s t jj| jS )N)dnsrdataZ _base64ifyr )r origin relativizekwr r r to_text$ s z DHCID.to_textc C s` g }x:|j j }|j r P |j s,tjj|j|jj qW dj |}t j |} | ||| S )N ) getZunescapeZ is_eol_or_eofZ is_identifierr Z exception SyntaxErrorappendvalueencodejoinbase64Z b64decode) clsr r tokr r ZchunkstZb64r r r r from_text' s zDHCID.from_textc C s |j | j d S )N)writer )r filecompressr r r r to_wire5 s z DHCID.to_wirec C s |||| j }| |||S )N)Zunwrap)r r r ZwireZcurrentZrdlenr r r r r from_wire8 s zDHCID.from_wire)NT)NT)NN)N) __name__ __module__ __qualname____doc__ __slots__r r classmethodr r! r" __classcell__r r )r r r s r )r Z dns.exceptionr r ZRdatar r r r r <module> s PK g\\m9Mr r 4 rdtypes/IN/__pycache__/NSAP_PTR.cpython-36.opt-1.pycnu [ 3 bW} @ s" d dl ZG dd dejjjZdS ) Nc @ s e Zd ZdZdS )NSAP_PTRzNSAP-PTR recordN)__name__ __module__ __qualname____doc__ r r /usr/lib/python3.6/NSAP_PTR.pyr s r )Zdns.rdtypes.nsbaseZdnsZrdtypesZnsbaseZUncompressedNSr r r r r <module> s PK g\g ) rdtypes/IN/__pycache__/WKS.cpython-36.pycnu [ 3 bW @ sX d dl Z d dlZd dlZd dlZd dlmZ e jdZe jdZ G dd dej j Z dS ) N)xrangetcpudpc sZ e Zd ZdZdddgZ fddZdd d Zedd d Zdd dZ edddZ Z S )WKSzWKS record @ivar address: the address @type address: string @ivar protocol: the protocol @type protocol: int @ivar bitmap: the bitmap @type bitmap: string @see: RFC 1035addressprotocolbitmapc s> t t| j|| || _|| _t|ts4t|| _n|| _d S )N)superr __init__r r isinstance bytearrayr )selfrdclassrdtyper r r ) __class__ /usr/lib/python3.6/WKS.pyr ) s z WKS.__init__NTc K sz g }xXt dt| jD ]D}| j| }x4t ddD ]&}|d|? @ r0|jt|d | q0W qW dj|}d| j| j|f S )Nr z%s %d %s)r lenr appendstrjoinr r ) r origin relativizekwbitsiZbytejtextr r r to_text2 s z WKS.to_textc C s |j }|j }|j r"t|}n tj|}t }x|j j } | j rJP | j j r`t| j } n8|t krx|t krxt d|t krd} nd} tj | j | } | d } t|} | | d k rx t| | d D ]}|jd qW || d| d ? B || < q4W tjj|}| |||||S )Nzprotocol must be TCP or UDPr r r r r )Z get_stringisdigitintsocketgetprotobynamer getZunescapeZ is_eol_or_eofvalue _proto_udp _proto_tcpNotImplementedErrorZ getservbynamer r r dnsrdataZ_truncate_bitmap)clsr r tokr r r r r tokenZservZ protocol_textr lr r r r from_text< s4 z WKS.from_textc C s< |j tjj| j tjd| j}|j | |j | j d S )Nz!B) writer, ipv4Z inet_atonr structpackr r )r filecompressr r r r r to_wire\ s z WKS.to_wirec C sj t jj|||d }tjd||d |d \}|d7 }|d8 }|||| j } | ||||| S )N z!B )r, r4 Z inet_ntoar5 unpackZunwrap) r. r r ZwireZcurrentZrdlenr r r r r r r from_wireb s z WKS.from_wire)NT)NT)NN)N) __name__ __module__ __qualname____doc__ __slots__r r! classmethodr2 r9 r= __classcell__r r )r r r s r ) r% r5 Zdns.ipv4r, Z dns.rdataZ dns._compatr r& r* r) r- ZRdatar r r r r <module> s PK g\"ݯ! ! ( rdtypes/IN/__pycache__/PX.cpython-36.pycnu [ 3 bWB @ s8 d dl Z d dlZd dlZd dlZG dd dejjZdS ) Nc sd e Zd ZdZdddgZ fddZdd d Zedd d Zdd dZ edddZ dddZ Z S )PXzPX record. @ivar preference: the preference value @type preference: int @ivar map822: the map822 name @type map822: dns.name.Name object @ivar mapx400: the mapx400 name @type mapx400: dns.name.Name object @see: RFC 2163 preferencemap822mapx400c s( t t| j|| || _|| _|| _d S )N)superr __init__r r r )selfrdclassrdtyper r r ) __class__ /usr/lib/python3.6/PX.pyr % s z PX.__init__NTc K s, | j j||}| jj||}d| j||f S )Nz%d %s %s)r choose_relativityr r )r origin relativizekwr r r r r to_text+ s z PX.to_textc C sJ |j }|j }|j||}|jd }|j||}|j | |||||S )N)Z get_uint16Zget_namer Zget_eol) clsr r tokr r r r r r r r from_text0 s z PX.from_textc C s< t jd| j}|j| | jj|d | | jj|d | d S )Nz!H)structpackr writer to_wirer )r filecompressr Zprefr r r r : s z PX.to_wirec C s t jd|||d \}|d7 }|d8 }tjj|d || |\}} | |krXtjj|| 7 }|| 8 }|d k rz|j|}tjj|d || |\} } | |krtjj|d k r| j|} | ||||| S )Nz!H )r unpackdnsname from_wireZ exceptionZ FormErrorr ) r r r ZwireZcurrentZrdlenr r r Zcusedr r r r r @ s$ z PX.from_wirec C s$ | j j||| _ | jj||| _d S )N)r r r )r r r r r r r U s zPX.choose_relativity)NT)NT)NN)N)NT) __name__ __module__ __qualname____doc__ __slots__r r classmethodr r r r __classcell__r r )r r r s r )r Z dns.exceptionr Z dns.rdataZdns.nameZrdataZRdatar r r r r <module> s PK g\\m9Mr r . rdtypes/IN/__pycache__/NSAP_PTR.cpython-36.pycnu [ 3 bW} @ s" d dl ZG dd dejjjZdS ) Nc @ s e Zd ZdZdS )NSAP_PTRzNSAP-PTR recordN)__name__ __module__ __qualname____doc__ r r /usr/lib/python3.6/NSAP_PTR.pyr s r )Zdns.rdtypes.nsbaseZdnsZrdtypesZnsbaseZUncompressedNSr r r r r <module> s PK g\٣ * rdtypes/IN/__pycache__/AAAA.cpython-36.pycnu [ 3 bW @ s8 d dl Zd dlZd dlZd dlZG dd dejjZdS ) Nc sV e Zd ZdZdgZ fddZdddZedd d Zdd d Z edd dZ Z S )AAAAzhAAAA record. @ivar address: an IPv6 address @type address: string (in the standard IPv6 format)addressc s. t t| j|| tjjtjj| || _d S )N)superr __init__dnsinet inet_ptonAF_INET6r )selfrdclassrdtyper ) __class__ /usr/lib/python3.6/AAAA.pyr s z AAAA.__init__NTc K s | j S )N)r )r origin relativizekwr r r to_text% s z AAAA.to_textc C s |j }|j | |||S )N)Zget_identifierZget_eol)clsr r tokr r r r r r from_text( s zAAAA.from_textc C s |j tjjtjj| j d S )N)writer r r r r )r filecompressr r r r to_wire. s z AAAA.to_wirec C s* t jjt jj|||| }| |||S )N)r r Z inet_ntopr )r r r ZwireZcurrentZrdlenr r r r r from_wire1 s zAAAA.from_wire)NT)NT)NN)N) __name__ __module__ __qualname____doc__ __slots__r r classmethodr r r __classcell__r r )r r r s r )Z dns.exceptionr Zdns.inetZ dns.rdataZ dns.tokenizerZrdataZRdatar r r r r <module> s PK g\g * rdtypes/IN/__pycache__/NSAP.cpython-36.pycnu [ 3 bW @ s8 d dl Z d dlZd dlZd dlZG dd dejjZdS ) Nc sV e Zd ZdZdgZ fddZdddZedd d Zdd d Z edd dZ Z S )NSAPzTNSAP record. @ivar address: a NASP @type address: string @see: RFC 1706addressc s t t| j|| || _d S )N)superr __init__r )selfrdclassrdtyper ) __class__ /usr/lib/python3.6/NSAP.pyr ! s z NSAP.__init__NTc K s dt j| jj S )Nz0x%s)binasciiZhexlifyr decode)r origin relativizekwr r r to_text% s z NSAP.to_textc C sv |j }|j |dd dkr,tjjd|dd jdd}t|d dkr\tjjdtj|j }| |||S )Nr Z0xz string does not start with 0x. zhexstring has odd length) Z get_stringZget_eoldnsZ exception SyntaxErrorreplacelenr Z unhexlifyencode)clsr r tokr r r r r r from_text( s zNSAP.from_textc C s |j | j d S )N)writer )r filecompressr r r r to_wire4 s z NSAP.to_wirec C s |||| j }| |||S )N)Zunwrap)r r r ZwireZcurrentZrdlenr r r r r from_wire7 s zNSAP.from_wire)NT)NT)NN)N) __name__ __module__ __qualname____doc__ __slots__r r classmethodr r r! __classcell__r r )r r r s r )r Z dns.exceptionr Z dns.rdataZ dns.tokenizerZrdataZRdatar r r r r <module> s PK g\6Pb 4 rdtypes/IN/__pycache__/IPSECKEY.cpython-36.opt-1.pycnu [ 3 bW1 @ s@ d dl Z d dlZd dlZd dlZd dlZG dd dejjZdS ) Nc s^ e Zd ZdZdddddgZ fddZdd d Zedd dZdddZ edddZ Z S )IPSECKEYa IPSECKEY record @ivar precedence: the precedence for this key data @type precedence: int @ivar gateway_type: the gateway type @type gateway_type: int @ivar algorithm: the algorithm to use @type algorithm: int @ivar gateway: the public key @type gateway: None, IPv4 address, IPV6 address, or domain name @ivar key: the public key @type key: string @see: RFC 4025 precedence gateway_type algorithmgatewaykeyc s t t| j|| |dkr8|dkr2|d k r2tdd }nN|dkrTtjjtjj| n2|dkrptjjtjj| n|dkrzn td| || _ || _ || _ || _ || _ d S )Nr .z"invalid gateway for gateway type 0 z!invalid IPSECKEY gateway type: %d)superr __init__ SyntaxErrordnsinet inet_ptonAF_INETAF_INET6r r r r r )selfrdclassrdtyper r r r r ) __class__ /usr/lib/python3.6/IPSECKEY.pyr * s$ zIPSECKEY.__init__NTc K s| | j dkrd}nJ| j dkr"| j}n8| j dkr4| j}n&| j dkrRt| jj||}ntdd| j| j | j|tjj | j f S )Nr r r r r zinvalid gateway typez%d %d %d %s %s) r r strchoose_relativity ValueErrorr r r rdataZ _base64ifyr )r origin relativizekwr r r r to_textB s zIPSECKEY.to_textc C s |j }|j }|j }|dkr2|j j||} n|j } g } x:|j j } | j rVP | j sftj j | j | j j q@W dj| } tj| } | |||||| | S )Nr )Z get_uint8Zget_namer Z get_stringgetZunescapeZ is_eol_or_eofZ is_identifierr exceptionr appendvalueencodejoinbase64Z b64decode)clsr r tokr r r r r r ZchunkstZb64r r r r from_textQ s$ zIPSECKEY.from_textc C s t jd| j| j| j}|j| | jdkr,np| jdkrR|jtjjtjj | j nJ| jdkrx|jtjjtjj | j n$| jdkr| j j |d | nt d|j| j d S )Nz!BBBr r r r zinvalid gateway type)structpackr r r writer r r r r r to_wirer r )r filecompressr headerr r r r1 g s zIPSECKEY.to_wirec C s2 |dk rt jjtjd|||d }|d }|d7 }|d8 }|dkrNd } n|dkrt jjt jj|||d } |d7 }|d8 }n||dkrt jjt jj|||d } |d7 }|d8 }nD|dkrt j j |d || |\} } || 7 }|| 8 }n t jjd|||| j } | |||d ||d | | S ) Nr z!BBBr r r z invalid IPSECKEY gateway type) r r$ Z FormErrorr. unpackr Z inet_ntopr r name from_wireZunwrap) r* r r ZwireZcurrentZrdlenr r4 r r Zcusedr r r r r9 w s6 zIPSECKEY.from_wire)NT)NT)NN)N) __name__ __module__ __qualname____doc__ __slots__r r! classmethodr- r1 r9 __classcell__r r )r r r s r ) r. r) Z dns.exceptionr Zdns.inetZdns.namer ZRdatar r r r r <module> s PK g\ - rdtypes/IN/__pycache__/A.cpython-36.opt-1.pycnu [ 3 bW= @ s8 d dl Zd dlZd dlZd dlZG dd dejjZdS ) Nc sV e Zd ZdZdgZ fddZdddZedd d Zdd d Z edd dZ Z S )AznA record. @ivar address: an IPv4 address @type address: string (in the standard "dotted quad" format)addressc s( t t| j|| tjj| || _d S )N)superr __init__dnsipv4 inet_atonr )selfrdclassrdtyper ) __class__ /usr/lib/python3.6/A.pyr s z A.__init__NTc K s | j S )N)r )r origin relativizekwr r r to_text% s z A.to_textc C s |j }|j | |||S )N)Zget_identifierZget_eol)clsr r tokr r r r r r from_text( s z A.from_textc C s |j tjj| j d S )N)writer r r r )r filecompressr r r r to_wire. s z A.to_wirec C s( t jj|||| j }| |||S )N)r r Z inet_ntoadecode)r r r ZwireZcurrentZrdlenr r r r r from_wire1 s z A.from_wire)NT)NT)NN)N) __name__ __module__ __qualname____doc__ __slots__r r classmethodr r r __classcell__r r )r r r s r )Z dns.exceptionr Zdns.ipv4Z dns.rdataZ dns.tokenizerZrdataZRdatar r r r r <module> s PK g\= + rdtypes/IN/__pycache__/DHCID.cpython-36.pycnu [ 3 bW @ s( d dl Z d dlZG dd dejjZdS ) Nc sV e Zd ZdZdgZ fddZdddZedd d Zdd d Z edd dZ Z S )DHCIDzDHCID record @ivar data: the data (the content of the RR is opaque as far as the DNS is concerned) @type data: string @see: RFC 4701datac s t t| j|| || _d S )N)superr __init__r )selfrdclassrdtyper ) __class__ /usr/lib/python3.6/DHCID.pyr s zDHCID.__init__NTc K s t jj| jS )N)dnsrdataZ _base64ifyr )r origin relativizekwr r r to_text$ s z DHCID.to_textc C s` g }x:|j j }|j r P |j s,tjj|j|jj qW dj |}t j |} | ||| S )N ) getZunescapeZ is_eol_or_eofZ is_identifierr Z exception SyntaxErrorappendvalueencodejoinbase64Z b64decode) clsr r tokr r ZchunkstZb64r r r r from_text' s zDHCID.from_textc C s |j | j d S )N)writer )r filecompressr r r r to_wire5 s z DHCID.to_wirec C s |||| j }| |||S )N)Zunwrap)r r r ZwireZcurrentZrdlenr r r r r from_wire8 s zDHCID.from_wire)NT)NT)NN)N) __name__ __module__ __qualname____doc__ __slots__r r classmethodr r! r" __classcell__r r )r r r s r )r Z dns.exceptionr r ZRdatar r r r r <module> s PK g\" ) rdtypes/IN/__pycache__/APL.cpython-36.pycnu [ 3 bWt @ sd d dl Z d dlZd dlZd dlZd dlZd dlZd dlmZ G dd de Z G dd dej j Z dS ) N)xrangec @ s4 e Zd ZdZddddgZdd Zdd Zd d Zd S ) APLItema' An APL list item. @ivar family: the address family (IANA address family registry) @type family: int @ivar negation: is this item negated? @type negation: bool @ivar address: the address @type address: string @ivar prefix: the prefix length @type prefix: int familynegationaddressprefixc C s || _ || _|| _|| _d S )N)r r r r )selfr r r r r /usr/lib/python3.6/APL.py__init__* s zAPLItem.__init__c C s2 | j rd| j| j| jf S d| j| j| jf S d S )Nz !%d:%s/%sz%d:%s/%s)r r r r )r r r r __str__0 s zAPLItem.__str__c C s | j dkr tjjtjj| j}n,| j dkr@tjjtjj| j}n tj| j}d}x6t t |d ddD ] }|| t dkrf|d }P qfW |d| }t |}|dk st | j r|dO }tjd| j | j|}|j| |j| d S )N r z!HBBr )r dnsinetZ inet_ptonAF_INETr AF_INET6binasciiZ unhexlifyr lenchrAssertionErrorr structpackr write)r filer Zlastilheaderr r r to_wire6 s$ zAPLItem.to_wireN)__name__ __module__ __qualname____doc__ __slots__r r r r r r r r s r c sV e Zd ZdZdgZ fddZdddZedd d Zdd d Z edd dZ Z S )APLzfAPL record. @ivar items: a list of APL items @type items: list of APL_Item @see: RFC 3123itemsc s t t| j|| || _d S )N)superr& r r' )r rdclassrdtyper' ) __class__r r r Y s z APL.__init__NTc K s dj tt| jS )N )joinmapstrr' )r origin relativizekwr r r to_text] s z APL.to_textc C s g }x|j j }|j r P |j}|d dkr@d} |dd }nd} |jdd\} } t| } | jdd\} } t| } t| | | | }|j| qW | |||S )Nr !Tr F:/)getZunescapeZ is_eol_or_eofvaluesplitintr append)clsr) r* tokr0 r1 r' tokenitemr r restr r r r r from_text` s" z APL.from_textc C s x| j D ]}|j| qW d S )N)r' r )r r compressr0 r? r r r r v s z APL.to_wirec C sT g }x@|dkrP |dk r"t jjtjd|||d }|d } | dkrXd} | d8 } nd} |d7 }|d8 }|| k r|t jj|||| j } t| } |d d kr| dk r| d d| 7 } t jjt jj | } nD|d dkr | d k r| d d | 7 } t jjt jj | } n | j d } || 7 }|| 8 }t |d | | |d } |j | qW | |||S ) Nr z!HBBr Tr Fr hex_codec)r Z exceptionZ FormErrorr unpackZunwrapr r Z inet_ntopr r encoder r; )r< r) r* ZwireZcurrentZrdlenr0 r' r Zafdlenr r r r? r r r from_wirez s@ z APL.from_wire)NT)NT)NN)N) r! r" r# r$ r% r r3 classmethodrA r rJ __classcell__r r )r+ r r& O s r& )r r Z dns.exceptionr Zdns.inetZ dns.rdataZ dns.tokenizerZ dns._compatr objectr ZrdataZRdatar& r r r r <module> s 5PK g\6Pb . rdtypes/IN/__pycache__/IPSECKEY.cpython-36.pycnu [ 3 bW1 @ s@ d dl Z d dlZd dlZd dlZd dlZG dd dejjZdS ) Nc s^ e Zd ZdZdddddgZ fddZdd d Zedd dZdddZ edddZ Z S )IPSECKEYa IPSECKEY record @ivar precedence: the precedence for this key data @type precedence: int @ivar gateway_type: the gateway type @type gateway_type: int @ivar algorithm: the algorithm to use @type algorithm: int @ivar gateway: the public key @type gateway: None, IPv4 address, IPV6 address, or domain name @ivar key: the public key @type key: string @see: RFC 4025 precedence gateway_type algorithmgatewaykeyc s t t| j|| |dkr8|dkr2|d k r2tdd }nN|dkrTtjjtjj| n2|dkrptjjtjj| n|dkrzn td| || _ || _ || _ || _ || _ d S )Nr .z"invalid gateway for gateway type 0 z!invalid IPSECKEY gateway type: %d)superr __init__ SyntaxErrordnsinet inet_ptonAF_INETAF_INET6r r r r r )selfrdclassrdtyper r r r r ) __class__ /usr/lib/python3.6/IPSECKEY.pyr * s$ zIPSECKEY.__init__NTc K s| | j dkrd}nJ| j dkr"| j}n8| j dkr4| j}n&| j dkrRt| jj||}ntdd| j| j | j|tjj | j f S )Nr r r r r zinvalid gateway typez%d %d %d %s %s) r r strchoose_relativity ValueErrorr r r rdataZ _base64ifyr )r origin relativizekwr r r r to_textB s zIPSECKEY.to_textc C s |j }|j }|j }|dkr2|j j||} n|j } g } x:|j j } | j rVP | j sftj j | j | j j q@W dj| } tj| } | |||||| | S )Nr )Z get_uint8Zget_namer Z get_stringgetZunescapeZ is_eol_or_eofZ is_identifierr exceptionr appendvalueencodejoinbase64Z b64decode)clsr r tokr r r r r r ZchunkstZb64r r r r from_textQ s$ zIPSECKEY.from_textc C s t jd| j| j| j}|j| | jdkr,np| jdkrR|jtjjtjj | j nJ| jdkrx|jtjjtjj | j n$| jdkr| j j |d | nt d|j| j d S )Nz!BBBr r r r zinvalid gateway type)structpackr r r writer r r r r r to_wirer r )r filecompressr headerr r r r1 g s zIPSECKEY.to_wirec C s2 |dk rt jjtjd|||d }|d }|d7 }|d8 }|dkrNd } n|dkrt jjt jj|||d } |d7 }|d8 }n||dkrt jjt jj|||d } |d7 }|d8 }nD|dkrt j j |d || |\} } || 7 }|| 8 }n t jjd|||| j } | |||d ||d | | S ) Nr z!BBBr r r z invalid IPSECKEY gateway type) r r$ Z FormErrorr. unpackr Z inet_ntopr r name from_wireZunwrap) r* r r ZwireZcurrentZrdlenr r4 r r Zcusedr r r r r9 w s6 zIPSECKEY.from_wire)NT)NT)NN)N) __name__ __module__ __qualname____doc__ __slots__r r! classmethodr- r1 r9 __classcell__r r )r r r s r ) r. r) Z dns.exceptionr Zdns.inetZdns.namer ZRdatar r r r r <module> s PK g\ ) rdtypes/IN/__pycache__/SRV.cpython-36.pycnu [ 3 bW @ s8 d dl Z d dlZd dlZd dlZG dd dejjZdS ) Nc sf e Zd ZdZddddgZ fddZdd d Zedd d ZdddZ edddZ dddZ Z S )SRVa SRV record @ivar priority: the priority @type priority: int @ivar weight: the weight @type weight: int @ivar port: the port of the service @type port: int @ivar target: the target host @type target: dns.name.Name object @see: RFC 2782priorityweightporttargetc s. t t| j|| || _|| _|| _|| _d S )N)superr __init__r r r r )selfrdclassrdtyper r r r ) __class__ /usr/lib/python3.6/SRV.pyr ' s z SRV.__init__NTc K s$ | j j||}d| j| j| j|f S )Nz %d %d %d %s)r choose_relativityr r r )r origin relativizekwr r r r to_text. s z SRV.to_textc C sH |j }|j }|j }|jd } | j||} |j | |||||| S )N)Z get_uint16Zget_namer Zget_eol) clsr r tokr r r r r r r r r from_text3 s z SRV.from_textc C s4 t jd| j| j| j}|j| | jj||| d S )Nz!HHH)structpackr r r writer to_wire)r filecompressr Z three_intsr r r r = s z SRV.to_wirec C s t jd|||d \}}} |d7 }|d8 }tjj|d || |\} } | |kr\tjj|d k rn| j|} | ||||| | S )Nz!HHH )r unpackdnsname from_wireZ exceptionZ FormErrorr ) r r r ZwireZcurrentZrdlenr r r r r Zcusedr r r r! B s z SRV.from_wirec C s | j j||| _ d S )N)r r )r r r r r r r P s zSRV.choose_relativity)NT)NT)NN)N)NT) __name__ __module__ __qualname____doc__ __slots__r r classmethodr r r! r __classcell__r r )r r r s r )r Z dns.exceptionr Z dns.rdataZdns.nameZrdataZRdatar r r r r <module> s PK g\"ݯ! ! . rdtypes/IN/__pycache__/PX.cpython-36.opt-1.pycnu [ 3 bWB @ s8 d dl Z d dlZd dlZd dlZG dd dejjZdS ) Nc sd e Zd ZdZdddgZ fddZdd d Zedd d Zdd dZ edddZ dddZ Z S )PXzPX record. @ivar preference: the preference value @type preference: int @ivar map822: the map822 name @type map822: dns.name.Name object @ivar mapx400: the mapx400 name @type mapx400: dns.name.Name object @see: RFC 2163 preferencemap822mapx400c s( t t| j|| || _|| _|| _d S )N)superr __init__r r r )selfrdclassrdtyper r r ) __class__ /usr/lib/python3.6/PX.pyr % s z PX.__init__NTc K s, | j j||}| jj||}d| j||f S )Nz%d %s %s)r choose_relativityr r )r origin relativizekwr r r r r to_text+ s z PX.to_textc C sJ |j }|j }|j||}|jd }|j||}|j | |||||S )N)Z get_uint16Zget_namer Zget_eol) clsr r tokr r r r r r r r from_text0 s z PX.from_textc C s< t jd| j}|j| | jj|d | | jj|d | d S )Nz!H)structpackr writer to_wirer )r filecompressr Zprefr r r r : s z PX.to_wirec C s t jd|||d \}|d7 }|d8 }tjj|d || |\}} | |krXtjj|| 7 }|| 8 }|d k rz|j|}tjj|d || |\} } | |krtjj|d k r| j|} | ||||| S )Nz!H )r unpackdnsname from_wireZ exceptionZ FormErrorr ) r r r ZwireZcurrentZrdlenr r r Zcusedr r r r r @ s$ z PX.from_wirec C s$ | j j||| _ | jj||| _d S )N)r r r )r r r r r r r U s zPX.choose_relativity)NT)NT)NN)N)NT) __name__ __module__ __qualname____doc__ __slots__r r classmethodr r r r __classcell__r r )r r r s r )r Z dns.exceptionr Z dns.rdataZdns.nameZrdataZRdatar r r r r <module> s PK g\T` ` ( rdtypes/IN/__pycache__/KX.cpython-36.pycnu [ 3 bWq @ s" d dl ZG dd dejjjZdS ) Nc @ s e Zd ZdZdS )KXz KX recordN)__name__ __module__ __qualname____doc__ r r /usr/lib/python3.6/KX.pyr s r )Zdns.rdtypes.mxbaseZdnsZrdtypesZmxbaseZUncompressedMXr r r r r <module> s PK g\S 4 rdtypes/IN/__pycache__/__init__.cpython-36.opt-1.pycnu [ 3 bW @ s" d Z ddddddddd d d g Zd S ) z Class IN rdata type classes.AZAAAAZAPLZDHCIDZKXZNAPTRZNSAPZNSAP_PTRZPXZSRVZWKSN)__doc____all__ r r /usr/lib/python3.6/__init__.py<module> s PK g\g 0 rdtypes/IN/__pycache__/NSAP.cpython-36.opt-1.pycnu [ 3 bW @ s8 d dl Z d dlZd dlZd dlZG dd dejjZdS ) Nc sV e Zd ZdZdgZ fddZdddZedd d Zdd d Z edd dZ Z S )NSAPzTNSAP record. @ivar address: a NASP @type address: string @see: RFC 1706addressc s t t| j|| || _d S )N)superr __init__r )selfrdclassrdtyper ) __class__ /usr/lib/python3.6/NSAP.pyr ! s z NSAP.__init__NTc K s dt j| jj S )Nz0x%s)binasciiZhexlifyr decode)r origin relativizekwr r r to_text% s z NSAP.to_textc C sv |j }|j |dd dkr,tjjd|dd jdd}t|d dkr\tjjdtj|j }| |||S )Nr Z0xz string does not start with 0x. zhexstring has odd length) Z get_stringZget_eoldnsZ exception SyntaxErrorreplacelenr Z unhexlifyencode)clsr r tokr r r r r r from_text( s zNSAP.from_textc C s |j | j d S )N)writer )r filecompressr r r r to_wire4 s z NSAP.to_wirec C s |||| j }| |||S )N)Zunwrap)r r r ZwireZcurrentZrdlenr r r r r from_wire7 s zNSAP.from_wire)NT)NT)NN)N) __name__ __module__ __qualname____doc__ __slots__r r classmethodr r r! __classcell__r r )r r r s r )r Z dns.exceptionr Z dns.rdataZ dns.tokenizerZrdataZRdatar r r r r <module> s PK g\ / rdtypes/IN/__pycache__/APL.cpython-36.opt-1.pycnu [ 3 bWt @ sd d dl Z d dlZd dlZd dlZd dlZd dlZd dlmZ G dd de Z G dd dej j Z dS ) N)xrangec @ s4 e Zd ZdZddddgZdd Zdd Zd d Zd S ) APLItema' An APL list item. @ivar family: the address family (IANA address family registry) @type family: int @ivar negation: is this item negated? @type negation: bool @ivar address: the address @type address: string @ivar prefix: the prefix length @type prefix: int familynegationaddressprefixc C s || _ || _|| _|| _d S )N)r r r r )selfr r r r r /usr/lib/python3.6/APL.py__init__* s zAPLItem.__init__c C s2 | j rd| j| j| jf S d| j| j| jf S d S )Nz !%d:%s/%sz%d:%s/%s)r r r r )r r r r __str__0 s zAPLItem.__str__c C s | j dkr tjjtjj| j}n,| j dkr@tjjtjj| j}n tj| j}d}x6t t |d ddD ] }|| t dkrf|d }P qfW |d| }t |}| j r|dO }t jd| j | j|}|j| |j| d S )N r z!HBBr )r dnsinetZ inet_ptonAF_INETr AF_INET6binasciiZ unhexlifyr lenchrr structpackr write)r filer Zlastilheaderr r r to_wire6 s" zAPLItem.to_wireN)__name__ __module__ __qualname____doc__ __slots__r r r r r r r r s r c sV e Zd ZdZdgZ fddZdddZedd d Zdd d Z edd dZ Z S )APLzfAPL record. @ivar items: a list of APL items @type items: list of APL_Item @see: RFC 3123itemsc s t t| j|| || _d S )N)superr% r r& )r rdclassrdtyper& ) __class__r r r Y s z APL.__init__NTc K s dj tt| jS )N )joinmapstrr& )r origin relativizekwr r r to_text] s z APL.to_textc C s g }x|j j }|j r P |j}|d dkr@d} |dd }nd} |jdd\} } t| } | jdd\} } t| } t| | | | }|j| qW | |||S )Nr !Tr F:/)getZunescapeZ is_eol_or_eofvaluesplitintr append)clsr( r) tokr/ r0 r& tokenitemr r restr r r r r from_text` s" z APL.from_textc C s x| j D ]}|j| qW d S )N)r& r )r r compressr/ r> r r r r v s z APL.to_wirec C sT g }x@|dkrP |dk r"t jjtjd|||d }|d } | dkrXd} | d8 } nd} |d7 }|d8 }|| k r|t jj|||| j } t| } |d d kr| dk r| d d| 7 } t jjt jj | } nD|d dkr | d k r| d d | 7 } t jjt jj | } n | j d } || 7 }|| 8 }t |d | | |d } |j | qW | |||S ) Nr z!HBBr Tr Fr hex_codec)r Z exceptionZ FormErrorr unpackZunwrapr r Z inet_ntopr r encoder r: )r; r( r) ZwireZcurrentZrdlenr/ r& r Zafdlenr r r r> r r r from_wirez s@ z APL.from_wire)NT)NT)NN)N) r r! r" r# r$ r r2 classmethodr@ r rI __classcell__r r )r* r r% O s r% )r r Z dns.exceptionr Zdns.inetZ dns.rdataZ dns.tokenizerZ dns._compatr objectr ZrdataZRdatar% r r r r <module> s 5PK g\ + rdtypes/IN/__pycache__/NAPTR.cpython-36.pycnu [ 3 bWv @ sX d dl Z d dlZd dlZd dlZd dlmZmZ dd Zdd Z G dd dej j Z dS ) N)xrange text_typec C s4 t |}|dk st| jtjd| | j| d S )N z!B)lenAssertionErrorwritestructpack)filesl r /usr/lib/python3.6/NAPTR.py _write_string s r c C s t | tr| j S | S )N) isinstancer encode)valuer r r _sanitize s r c sj e Zd ZdZddddddgZ fdd Zdd d ZedddZdddZ edddZ dddZ Z S )NAPTRa} NAPTR record @ivar order: order @type order: int @ivar preference: preference @type preference: int @ivar flags: flags @type flags: string @ivar service: service @type service: string @ivar regexp: regular expression @type regexp: string @ivar replacement: replacement name @type replacement: dns.name.Name object @see: RFC 3403order preferenceflagsserviceregexp replacementc sF t t| j|| t|| _t|| _t|| _|| _|| _|| _ d S )N) superr __init__r r r r r r r ) selfrdclassrdtyper r r r r r ) __class__r r r : s zNAPTR.__init__NTc K sD | j j||}d| j| jtjj| jtjj| jtjj| j |f S )Nz%d %d "%s" "%s" "%s" %s) r choose_relativityr r dnsrdataZ _escapifyr r r )r origin relativizekwr r r r to_textD s z NAPTR.to_textc C sZ |j }|j }|j }|j } |j } |j } | j||} |j | |||||| | | S )N)Z get_uint16Z get_stringZget_namer! Zget_eol) clsr r tokr$ r% r r r r r r r r r from_textM s zNAPTR.from_textc C sT t jd| j| j}|j| t|| j t|| j t|| j | j j ||| d S )Nz!HH) r r r r r r r r r r to_wire)r r compressr$ Ztwo_intsr r r r+ Z s z NAPTR.to_wirec C s t jd|||d \}}|d7 }|d8 }g } xntdD ]b} || } |d7 }|d8 }| |ksf|dk rntjj|||| j } || 7 }|| 8 }| j| q:W tjj |d || |\} }||krtjj|d k r| j |} | ||||| d | d | d | S )Nz!HH r ) r unpackr r" Z exceptionZ FormErrorZunwrapappendname from_wirer% )r( r r ZwireZcurrentZrdlenr$ r r Zstringsir r r Zcusedr r r r4 b s, zNAPTR.from_wirec C s | j j||| _ d S )N)r r! )r r$ r% r r r r! { s zNAPTR.choose_relativity)NT)NT)NN)N)NT) __name__ __module__ __qualname____doc__ __slots__r r' classmethodr* r+ r4 r! __classcell__r r )r r r % s r ) r Z dns.exceptionr" Zdns.nameZ dns.rdataZ dns._compatr r r r r# ZRdatar r r r r <module> s PK g\T` ` . rdtypes/IN/__pycache__/KX.cpython-36.opt-1.pycnu [ 3 bWq @ s" d dl ZG dd dejjjZdS ) Nc @ s e Zd ZdZdS )KXz KX recordN)__name__ __module__ __qualname____doc__ r r /usr/lib/python3.6/KX.pyr s r )Zdns.rdtypes.mxbaseZdnsZrdtypesZmxbaseZUncompressedMXr r r r r <module> s PK g\٣ 0 rdtypes/IN/__pycache__/AAAA.cpython-36.opt-1.pycnu [ 3 bW @ s8 d dl Zd dlZd dlZd dlZG dd dejjZdS ) Nc sV e Zd ZdZdgZ fddZdddZedd d Zdd d Z edd dZ Z S )AAAAzhAAAA record. @ivar address: an IPv6 address @type address: string (in the standard IPv6 format)addressc s. t t| j|| tjjtjj| || _d S )N)superr __init__dnsinet inet_ptonAF_INET6r )selfrdclassrdtyper ) __class__ /usr/lib/python3.6/AAAA.pyr s z AAAA.__init__NTc K s | j S )N)r )r origin relativizekwr r r to_text% s z AAAA.to_textc C s |j }|j | |||S )N)Zget_identifierZget_eol)clsr r tokr r r r r r from_text( s zAAAA.from_textc C s |j tjjtjj| j d S )N)writer r r r r )r filecompressr r r r to_wire. s z AAAA.to_wirec C s* t jjt jj|||| }| |||S )N)r r Z inet_ntopr )r r r ZwireZcurrentZrdlenr r r r r from_wire1 s zAAAA.from_wire)NT)NT)NN)N) __name__ __module__ __qualname____doc__ __slots__r r classmethodr r r __classcell__r r )r r r s r )Z dns.exceptionr Zdns.inetZ dns.rdataZ dns.tokenizerZrdataZRdatar r r r r <module> s PK g\rO 1 rdtypes/IN/__pycache__/NAPTR.cpython-36.opt-1.pycnu [ 3 bWv @ sX d dl Z d dlZd dlZd dlZd dlmZmZ dd Zdd Z G dd dej j Z dS ) N)xrange text_typec C s( t |}| jtjd| | j| d S )Nz!B)lenwritestructpack)filesl r /usr/lib/python3.6/NAPTR.py _write_string s r c C s t | tr| j S | S )N) isinstancer encode)valuer r r _sanitize s r c sj e Zd ZdZddddddgZ fdd Zdd d ZedddZdddZ edddZ dddZ Z S )NAPTRa} NAPTR record @ivar order: order @type order: int @ivar preference: preference @type preference: int @ivar flags: flags @type flags: string @ivar service: service @type service: string @ivar regexp: regular expression @type regexp: string @ivar replacement: replacement name @type replacement: dns.name.Name object @see: RFC 3403order preferenceflagsserviceregexp replacementc sF t t| j|| t|| _t|| _t|| _|| _|| _|| _ d S )N) superr __init__r r r r r r r ) selfrdclassrdtyper r r r r r ) __class__r r r : s zNAPTR.__init__NTc K sD | j j||}d| j| jtjj| jtjj| jtjj| j |f S )Nz%d %d "%s" "%s" "%s" %s) r choose_relativityr r dnsrdataZ _escapifyr r r )r origin relativizekwr r r r to_textD s z NAPTR.to_textc C sZ |j }|j }|j }|j } |j } |j } | j||} |j | |||||| | | S )N)Z get_uint16Z get_stringZget_namer Zget_eol) clsr r tokr" r# r r r r r r r r r from_textM s zNAPTR.from_textc C sT t jd| j| j}|j| t|| j t|| j t|| j | j j ||| d S )Nz!HH) r r r r r r r r r r to_wire)r r compressr" Ztwo_intsr r r r) Z s z NAPTR.to_wirec C s t jd|||d \}}|d7 }|d8 }g } xntdD ]b} || } |d7 }|d8 }| |ksf|dk rntjj|||| j } || 7 }|| 8 }| j| q:W tjj |d || |\} }||krtjj|d k r| j |} | ||||| d | d | d | S )Nz!HH r ) r unpackr r Z exceptionZ FormErrorZunwrapappendname from_wirer# )r& r r ZwireZcurrentZrdlenr" r r Zstringsir r r Zcusedr r r r2 b s, zNAPTR.from_wirec C s | j j||| _ d S )N)r r )r r" r# r r r r { s zNAPTR.choose_relativity)NT)NT)NN)N)NT) __name__ __module__ __qualname____doc__ __slots__r r% classmethodr( r) r2 r __classcell__r r )r r r % s r ) r Z dns.exceptionr Zdns.nameZ dns.rdataZ dns._compatr r r r r! ZRdatar r r r r <module> s PK g\S . rdtypes/IN/__pycache__/__init__.cpython-36.pycnu [ 3 bW @ s" d Z ddddddddd d d g Zd S ) z Class IN rdata type classes.AZAAAAZAPLZDHCIDZKXZNAPTRZNSAPZNSAP_PTRZPXZSRVZWKSN)__doc____all__ r r /usr/lib/python3.6/__init__.py<module> s PK g\ ' rdtypes/IN/__pycache__/A.cpython-36.pycnu [ 3 bW= @ s8 d dl Zd dlZd dlZd dlZG dd dejjZdS ) Nc sV e Zd ZdZdgZ fddZdddZedd d Zdd d Z edd dZ Z S )AznA record. @ivar address: an IPv4 address @type address: string (in the standard "dotted quad" format)addressc s( t t| j|| tjj| || _d S )N)superr __init__dnsipv4 inet_atonr )selfrdclassrdtyper ) __class__ /usr/lib/python3.6/A.pyr s z A.__init__NTc K s | j S )N)r )r origin relativizekwr r r to_text% s z A.to_textc C s |j }|j | |||S )N)Zget_identifierZget_eol)clsr r tokr r r r r r from_text( s z A.from_textc C s |j tjj| j d S )N)writer r r r )r filecompressr r r r to_wire. s z A.to_wirec C s( t jj|||| j }| |||S )N)r r Z inet_ntoadecode)r r r ZwireZcurrentZrdlenr r r r r from_wire1 s z A.from_wire)NT)NT)NN)N) __name__ __module__ __qualname____doc__ __slots__r r classmethodr r r __classcell__r r )r r r s r )Z dns.exceptionr Zdns.ipv4Z dns.rdataZ dns.tokenizerZrdataZRdatar r r r r <module> s PK g\g / rdtypes/IN/__pycache__/WKS.cpython-36.opt-1.pycnu [ 3 bW @ sX d dl Z d dlZd dlZd dlZd dlmZ e jdZe jdZ G dd dej j Z dS ) N)xrangetcpudpc sZ e Zd ZdZdddgZ fddZdd d Zedd d Zdd dZ edddZ Z S )WKSzWKS record @ivar address: the address @type address: string @ivar protocol: the protocol @type protocol: int @ivar bitmap: the bitmap @type bitmap: string @see: RFC 1035addressprotocolbitmapc s> t t| j|| || _|| _t|ts4t|| _n|| _d S )N)superr __init__r r isinstance bytearrayr )selfrdclassrdtyper r r ) __class__ /usr/lib/python3.6/WKS.pyr ) s z WKS.__init__NTc K sz g }xXt dt| jD ]D}| j| }x4t ddD ]&}|d|? @ r0|jt|d | q0W qW dj|}d| j| j|f S )Nr z%s %d %s)r lenr appendstrjoinr r ) r origin relativizekwbitsiZbytejtextr r r to_text2 s z WKS.to_textc C s |j }|j }|j r"t|}n tj|}t }x|j j } | j rJP | j j r`t| j } n8|t krx|t krxt d|t krd} nd} tj | j | } | d } t|} | | d k rx t| | d D ]}|jd qW || d| d ? B || < q4W tjj|}| |||||S )Nzprotocol must be TCP or UDPr r r r r )Z get_stringisdigitintsocketgetprotobynamer getZunescapeZ is_eol_or_eofvalue _proto_udp _proto_tcpNotImplementedErrorZ getservbynamer r r dnsrdataZ_truncate_bitmap)clsr r tokr r r r r tokenZservZ protocol_textr lr r r r from_text< s4 z WKS.from_textc C s< |j tjj| j tjd| j}|j | |j | j d S )Nz!B) writer, ipv4Z inet_atonr structpackr r )r filecompressr r r r r to_wire\ s z WKS.to_wirec C sj t jj|||d }tjd||d |d \}|d7 }|d8 }|||| j } | ||||| S )N z!B )r, r4 Z inet_ntoar5 unpackZunwrap) r. r r ZwireZcurrentZrdlenr r r r r r r from_wireb s z WKS.from_wire)NT)NT)NN)N) __name__ __module__ __qualname____doc__ __slots__r r! classmethodr2 r9 r= __classcell__r r )r r r s r ) r% r5 Zdns.ipv4r, Z dns.rdataZ dns._compatr r& r* r) r- ZRdatar r r r r <module> s PK g\ rdtypes/IN/DHCID.pynu [ # Copyright (C) 2006, 2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. import base64 import dns.exception class DHCID(dns.rdata.Rdata): """DHCID record @ivar data: the data (the content of the RR is opaque as far as the DNS is concerned) @type data: string @see: RFC 4701""" __slots__ = ['data'] def __init__(self, rdclass, rdtype, data): super(DHCID, self).__init__(rdclass, rdtype) self.data = data def to_text(self, origin=None, relativize=True, **kw): return dns.rdata._base64ify(self.data) @classmethod def from_text(cls, rdclass, rdtype, tok, origin=None, relativize=True): chunks = [] while 1: t = tok.get().unescape() if t.is_eol_or_eof(): break if not t.is_identifier(): raise dns.exception.SyntaxError chunks.append(t.value.encode()) b64 = b''.join(chunks) data = base64.b64decode(b64) return cls(rdclass, rdtype, data) def to_wire(self, file, compress=None, origin=None): file.write(self.data) @classmethod def from_wire(cls, rdclass, rdtype, wire, current, rdlen, origin=None): data = wire[current: current + rdlen].unwrap() return cls(rdclass, rdtype, data) PK g\7q q rdtypes/IN/KX.pynu [ # Copyright (C) 2003-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. import dns.rdtypes.mxbase class KX(dns.rdtypes.mxbase.UncompressedMX): """KX record""" PK g\4= = rdtypes/IN/A.pynu [ # Copyright (C) 2003-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. import dns.exception import dns.ipv4 import dns.rdata import dns.tokenizer class A(dns.rdata.Rdata): """A record. @ivar address: an IPv4 address @type address: string (in the standard "dotted quad" format)""" __slots__ = ['address'] def __init__(self, rdclass, rdtype, address): super(A, self).__init__(rdclass, rdtype) # check that it's OK dns.ipv4.inet_aton(address) self.address = address def to_text(self, origin=None, relativize=True, **kw): return self.address @classmethod def from_text(cls, rdclass, rdtype, tok, origin=None, relativize=True): address = tok.get_identifier() tok.get_eol() return cls(rdclass, rdtype, address) def to_wire(self, file, compress=None, origin=None): file.write(dns.ipv4.inet_aton(self.address)) @classmethod def from_wire(cls, rdclass, rdtype, wire, current, rdlen, origin=None): address = dns.ipv4.inet_ntoa(wire[current: current + rdlen]).decode() return cls(rdclass, rdtype, address) PK g\mB B rdtypes/IN/PX.pynu [ # Copyright (C) 2003-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. import struct import dns.exception import dns.rdata import dns.name class PX(dns.rdata.Rdata): """PX record. @ivar preference: the preference value @type preference: int @ivar map822: the map822 name @type map822: dns.name.Name object @ivar mapx400: the mapx400 name @type mapx400: dns.name.Name object @see: RFC 2163""" __slots__ = ['preference', 'map822', 'mapx400'] def __init__(self, rdclass, rdtype, preference, map822, mapx400): super(PX, self).__init__(rdclass, rdtype) self.preference = preference self.map822 = map822 self.mapx400 = mapx400 def to_text(self, origin=None, relativize=True, **kw): map822 = self.map822.choose_relativity(origin, relativize) mapx400 = self.mapx400.choose_relativity(origin, relativize) return '%d %s %s' % (self.preference, map822, mapx400) @classmethod def from_text(cls, rdclass, rdtype, tok, origin=None, relativize=True): preference = tok.get_uint16() map822 = tok.get_name() map822 = map822.choose_relativity(origin, relativize) mapx400 = tok.get_name(None) mapx400 = mapx400.choose_relativity(origin, relativize) tok.get_eol() return cls(rdclass, rdtype, preference, map822, mapx400) def to_wire(self, file, compress=None, origin=None): pref = struct.pack("!H", self.preference) file.write(pref) self.map822.to_wire(file, None, origin) self.mapx400.to_wire(file, None, origin) @classmethod def from_wire(cls, rdclass, rdtype, wire, current, rdlen, origin=None): (preference, ) = struct.unpack('!H', wire[current: current + 2]) current += 2 rdlen -= 2 (map822, cused) = dns.name.from_wire(wire[: current + rdlen], current) if cused > rdlen: raise dns.exception.FormError current += cused rdlen -= cused if origin is not None: map822 = map822.relativize(origin) (mapx400, cused) = dns.name.from_wire(wire[: current + rdlen], current) if cused != rdlen: raise dns.exception.FormError if origin is not None: mapx400 = mapx400.relativize(origin) return cls(rdclass, rdtype, preference, map822, mapx400) def choose_relativity(self, origin=None, relativize=True): self.map822 = self.map822.choose_relativity(origin, relativize) self.mapx400 = self.mapx400.choose_relativity(origin, relativize) PK g\Wv v rdtypes/IN/NAPTR.pynu [ # Copyright (C) 2003-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. import struct import dns.exception import dns.name import dns.rdata from dns._compat import xrange, text_type def _write_string(file, s): l = len(s) assert l < 256 file.write(struct.pack('!B', l)) file.write(s) def _sanitize(value): if isinstance(value, text_type): return value.encode() return value class NAPTR(dns.rdata.Rdata): """NAPTR record @ivar order: order @type order: int @ivar preference: preference @type preference: int @ivar flags: flags @type flags: string @ivar service: service @type service: string @ivar regexp: regular expression @type regexp: string @ivar replacement: replacement name @type replacement: dns.name.Name object @see: RFC 3403""" __slots__ = ['order', 'preference', 'flags', 'service', 'regexp', 'replacement'] def __init__(self, rdclass, rdtype, order, preference, flags, service, regexp, replacement): super(NAPTR, self).__init__(rdclass, rdtype) self.flags = _sanitize(flags) self.service = _sanitize(service) self.regexp = _sanitize(regexp) self.order = order self.preference = preference self.replacement = replacement def to_text(self, origin=None, relativize=True, **kw): replacement = self.replacement.choose_relativity(origin, relativize) return '%d %d "%s" "%s" "%s" %s' % \ (self.order, self.preference, dns.rdata._escapify(self.flags), dns.rdata._escapify(self.service), dns.rdata._escapify(self.regexp), replacement) @classmethod def from_text(cls, rdclass, rdtype, tok, origin=None, relativize=True): order = tok.get_uint16() preference = tok.get_uint16() flags = tok.get_string() service = tok.get_string() regexp = tok.get_string() replacement = tok.get_name() replacement = replacement.choose_relativity(origin, relativize) tok.get_eol() return cls(rdclass, rdtype, order, preference, flags, service, regexp, replacement) def to_wire(self, file, compress=None, origin=None): two_ints = struct.pack("!HH", self.order, self.preference) file.write(two_ints) _write_string(file, self.flags) _write_string(file, self.service) _write_string(file, self.regexp) self.replacement.to_wire(file, compress, origin) @classmethod def from_wire(cls, rdclass, rdtype, wire, current, rdlen, origin=None): (order, preference) = struct.unpack('!HH', wire[current: current + 4]) current += 4 rdlen -= 4 strings = [] for i in xrange(3): l = wire[current] current += 1 rdlen -= 1 if l > rdlen or rdlen < 0: raise dns.exception.FormError s = wire[current: current + l].unwrap() current += l rdlen -= l strings.append(s) (replacement, cused) = dns.name.from_wire(wire[: current + rdlen], current) if cused != rdlen: raise dns.exception.FormError if origin is not None: replacement = replacement.relativize(origin) return cls(rdclass, rdtype, order, preference, strings[0], strings[1], strings[2], replacement) def choose_relativity(self, origin=None, relativize=True): self.replacement = self.replacement.choose_relativity(origin, relativize) PK g\RJ6r rdtypes/IN/__init__.pynu [ # Copyright (C) 2003-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. """Class IN rdata type classes.""" __all__ = [ 'A', 'AAAA', 'APL', 'DHCID', 'KX', 'NAPTR', 'NSAP', 'NSAP_PTR', 'PX', 'SRV', 'WKS', ] PK g\ rdtypes/IN/AAAA.pynu [ # Copyright (C) 2003-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. import dns.exception import dns.inet import dns.rdata import dns.tokenizer class AAAA(dns.rdata.Rdata): """AAAA record. @ivar address: an IPv6 address @type address: string (in the standard IPv6 format)""" __slots__ = ['address'] def __init__(self, rdclass, rdtype, address): super(AAAA, self).__init__(rdclass, rdtype) # check that it's OK dns.inet.inet_pton(dns.inet.AF_INET6, address) self.address = address def to_text(self, origin=None, relativize=True, **kw): return self.address @classmethod def from_text(cls, rdclass, rdtype, tok, origin=None, relativize=True): address = tok.get_identifier() tok.get_eol() return cls(rdclass, rdtype, address) def to_wire(self, file, compress=None, origin=None): file.write(dns.inet.inet_pton(dns.inet.AF_INET6, self.address)) @classmethod def from_wire(cls, rdclass, rdtype, wire, current, rdlen, origin=None): address = dns.inet.inet_ntop(dns.inet.AF_INET6, wire[current: current + rdlen]) return cls(rdclass, rdtype, address) PK g\о rdtypes/ANY/DNSKEY.pynu [ # Copyright (C) 2004-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. import dns.rdtypes.dnskeybase from dns.rdtypes.dnskeybase import flags_to_text_set, flags_from_text_set __all__ = ['flags_to_text_set', 'flags_from_text_set'] class DNSKEY(dns.rdtypes.dnskeybase.DNSKEYBase): """DNSKEY record""" PK g\GR R rdtypes/ANY/NSEC.pynu [ # Copyright (C) 2004-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. import struct import dns.exception import dns.rdata import dns.rdatatype import dns.name from dns._compat import xrange class NSEC(dns.rdata.Rdata): """NSEC record @ivar next: the next name @type next: dns.name.Name object @ivar windows: the windowed bitmap list @type windows: list of (window number, string) tuples""" __slots__ = ['next', 'windows'] def __init__(self, rdclass, rdtype, next, windows): super(NSEC, self).__init__(rdclass, rdtype) self.next = next self.windows = windows def to_text(self, origin=None, relativize=True, **kw): next = self.next.choose_relativity(origin, relativize) text = '' for (window, bitmap) in self.windows: bits = [] for i in xrange(0, len(bitmap)): byte = bitmap[i] for j in xrange(0, 8): if byte & (0x80 >> j): bits.append(dns.rdatatype.to_text(window * 256 + i * 8 + j)) text += (' ' + ' '.join(bits)) return '%s%s' % (next, text) @classmethod def from_text(cls, rdclass, rdtype, tok, origin=None, relativize=True): next = tok.get_name() next = next.choose_relativity(origin, relativize) rdtypes = [] while 1: token = tok.get().unescape() if token.is_eol_or_eof(): break nrdtype = dns.rdatatype.from_text(token.value) if nrdtype == 0: raise dns.exception.SyntaxError("NSEC with bit 0") if nrdtype > 65535: raise dns.exception.SyntaxError("NSEC with bit > 65535") rdtypes.append(nrdtype) rdtypes.sort() window = 0 octets = 0 prior_rdtype = 0 bitmap = bytearray(b'\0' * 32) windows = [] for nrdtype in rdtypes: if nrdtype == prior_rdtype: continue prior_rdtype = nrdtype new_window = nrdtype // 256 if new_window != window: windows.append((window, bitmap[0:octets])) bitmap = bytearray(b'\0' * 32) window = new_window offset = nrdtype % 256 byte = offset // 8 bit = offset % 8 octets = byte + 1 bitmap[byte] = bitmap[byte] | (0x80 >> bit) windows.append((window, bitmap[0:octets])) return cls(rdclass, rdtype, next, windows) def to_wire(self, file, compress=None, origin=None): self.next.to_wire(file, None, origin) for (window, bitmap) in self.windows: file.write(struct.pack('!BB', window, len(bitmap))) file.write(bitmap) @classmethod def from_wire(cls, rdclass, rdtype, wire, current, rdlen, origin=None): (next, cused) = dns.name.from_wire(wire[: current + rdlen], current) current += cused rdlen -= cused windows = [] while rdlen > 0: if rdlen < 3: raise dns.exception.FormError("NSEC too short") window = wire[current] octets = wire[current + 1] if octets == 0 or octets > 32: raise dns.exception.FormError("bad NSEC octets") current += 2 rdlen -= 2 if rdlen < octets: raise dns.exception.FormError("bad NSEC bitmap length") bitmap = bytearray(wire[current: current + octets].unwrap()) current += octets rdlen -= octets windows.append((window, bitmap)) if origin is not None: next = next.relativize(origin) return cls(rdclass, rdtype, next, windows) def choose_relativity(self, origin=None, relativize=True): self.next = self.next.choose_relativity(origin, relativize) PK g\ rdtypes/ANY/RP.pynu [ # Copyright (C) 2003-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. import dns.exception import dns.rdata import dns.name class RP(dns.rdata.Rdata): """RP record @ivar mbox: The responsible person's mailbox @type mbox: dns.name.Name object @ivar txt: The owner name of a node with TXT records, or the root name if no TXT records are associated with this RP. @type txt: dns.name.Name object @see: RFC 1183""" __slots__ = ['mbox', 'txt'] def __init__(self, rdclass, rdtype, mbox, txt): super(RP, self).__init__(rdclass, rdtype) self.mbox = mbox self.txt = txt def to_text(self, origin=None, relativize=True, **kw): mbox = self.mbox.choose_relativity(origin, relativize) txt = self.txt.choose_relativity(origin, relativize) return "%s %s" % (str(mbox), str(txt)) @classmethod def from_text(cls, rdclass, rdtype, tok, origin=None, relativize=True): mbox = tok.get_name() txt = tok.get_name() mbox = mbox.choose_relativity(origin, relativize) txt = txt.choose_relativity(origin, relativize) tok.get_eol() return cls(rdclass, rdtype, mbox, txt) def to_wire(self, file, compress=None, origin=None): self.mbox.to_wire(file, None, origin) self.txt.to_wire(file, None, origin) def to_digestable(self, origin=None): return self.mbox.to_digestable(origin) + \ self.txt.to_digestable(origin) @classmethod def from_wire(cls, rdclass, rdtype, wire, current, rdlen, origin=None): (mbox, cused) = dns.name.from_wire(wire[: current + rdlen], current) current += cused rdlen -= cused if rdlen <= 0: raise dns.exception.FormError (txt, cused) = dns.name.from_wire(wire[: current + rdlen], current) if cused != rdlen: raise dns.exception.FormError if origin is not None: mbox = mbox.relativize(origin) txt = txt.relativize(origin) return cls(rdclass, rdtype, mbox, txt) def choose_relativity(self, origin=None, relativize=True): self.mbox = self.mbox.choose_relativity(origin, relativize) self.txt = self.txt.choose_relativity(origin, relativize) PK g\? d d rdtypes/ANY/EUI48.pynu [ # Copyright (C) 2015 Red Hat, Inc. # Author: Petr Spacek <pspacek@redhat.com> # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED 'AS IS' AND RED HAT DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. import dns.rdtypes.euibase class EUI48(dns.rdtypes.euibase.EUIBase): """EUI48 record @ivar fingerprint: 48-bit Extended Unique Identifier (EUI-48) @type fingerprint: string @see: rfc7043.txt""" byte_len = 6 # 0123456789ab (in hex) text_len = byte_len * 3 - 1 # 01-23-45-67-89-ab PK g\3,n n rdtypes/ANY/EUI64.pynu [ # Copyright (C) 2015 Red Hat, Inc. # Author: Petr Spacek <pspacek@redhat.com> # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED 'AS IS' AND RED HAT DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. import dns.rdtypes.euibase class EUI64(dns.rdtypes.euibase.EUIBase): """EUI64 record @ivar fingerprint: 64-bit Extended Unique Identifier (EUI-64) @type fingerprint: string @see: rfc7043.txt""" byte_len = 8 # 0123456789abcdef (in hex) text_len = byte_len * 3 - 1 # 01-23-45-67-89-ab-cd-ef PK g\7R R rdtypes/ANY/URI.pynu [ # Copyright (C) 2003-2007, 2009-2011 Nominum, Inc. # Copyright (C) 2015 Red Hat, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. import struct import dns.exception import dns.rdata import dns.name from dns._compat import text_type class URI(dns.rdata.Rdata): """URI record @ivar priority: the priority @type priority: int @ivar weight: the weight @type weight: int @ivar target: the target host @type target: dns.name.Name object @see: draft-faltstrom-uri-13""" __slots__ = ['priority', 'weight', 'target'] def __init__(self, rdclass, rdtype, priority, weight, target): super(URI, self).__init__(rdclass, rdtype) self.priority = priority self.weight = weight if len(target) < 1: raise dns.exception.SyntaxError("URI target cannot be empty") if isinstance(target, text_type): self.target = target.encode() else: self.target = target def to_text(self, origin=None, relativize=True, **kw): return '%d %d "%s"' % (self.priority, self.weight, self.target.decode()) @classmethod def from_text(cls, rdclass, rdtype, tok, origin=None, relativize=True): priority = tok.get_uint16() weight = tok.get_uint16() target = tok.get().unescape() if not (target.is_quoted_string() or target.is_identifier()): raise dns.exception.SyntaxError("URI target must be a string") tok.get_eol() return cls(rdclass, rdtype, priority, weight, target.value) def to_wire(self, file, compress=None, origin=None): two_ints = struct.pack("!HH", self.priority, self.weight) file.write(two_ints) file.write(self.target) @classmethod def from_wire(cls, rdclass, rdtype, wire, current, rdlen, origin=None): if rdlen < 5: raise dns.exception.FormError('URI RR is shorter than 5 octets') (priority, weight) = struct.unpack('!HH', wire[current: current + 4]) current += 4 rdlen -= 4 target = wire[current: current + rdlen] current += rdlen return cls(rdclass, rdtype, priority, weight, target) PK g\ rdtypes/ANY/CDNSKEY.pynu [ # Copyright (C) 2004-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. import dns.rdtypes.dnskeybase from dns.rdtypes.dnskeybase import flags_to_text_set, flags_from_text_set __all__ = ['flags_to_text_set', 'flags_from_text_set'] class CDNSKEY(dns.rdtypes.dnskeybase.DNSKEYBase): """CDNSKEY record""" PK g\`0o o rdtypes/ANY/CERT.pynu [ # Copyright (C) 2003-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. import struct import base64 import dns.exception import dns.dnssec import dns.rdata import dns.tokenizer _ctype_by_value = { 1: 'PKIX', 2: 'SPKI', 3: 'PGP', 253: 'URI', 254: 'OID', } _ctype_by_name = { 'PKIX': 1, 'SPKI': 2, 'PGP': 3, 'URI': 253, 'OID': 254, } def _ctype_from_text(what): v = _ctype_by_name.get(what) if v is not None: return v return int(what) def _ctype_to_text(what): v = _ctype_by_value.get(what) if v is not None: return v return str(what) class CERT(dns.rdata.Rdata): """CERT record @ivar certificate_type: certificate type @type certificate_type: int @ivar key_tag: key tag @type key_tag: int @ivar algorithm: algorithm @type algorithm: int @ivar certificate: the certificate or CRL @type certificate: string @see: RFC 2538""" __slots__ = ['certificate_type', 'key_tag', 'algorithm', 'certificate'] def __init__(self, rdclass, rdtype, certificate_type, key_tag, algorithm, certificate): super(CERT, self).__init__(rdclass, rdtype) self.certificate_type = certificate_type self.key_tag = key_tag self.algorithm = algorithm self.certificate = certificate def to_text(self, origin=None, relativize=True, **kw): certificate_type = _ctype_to_text(self.certificate_type) return "%s %d %s %s" % (certificate_type, self.key_tag, dns.dnssec.algorithm_to_text(self.algorithm), dns.rdata._base64ify(self.certificate)) @classmethod def from_text(cls, rdclass, rdtype, tok, origin=None, relativize=True): certificate_type = _ctype_from_text(tok.get_string()) key_tag = tok.get_uint16() algorithm = dns.dnssec.algorithm_from_text(tok.get_string()) if algorithm < 0 or algorithm > 255: raise dns.exception.SyntaxError("bad algorithm type") chunks = [] while 1: t = tok.get().unescape() if t.is_eol_or_eof(): break if not t.is_identifier(): raise dns.exception.SyntaxError chunks.append(t.value.encode()) b64 = b''.join(chunks) certificate = base64.b64decode(b64) return cls(rdclass, rdtype, certificate_type, key_tag, algorithm, certificate) def to_wire(self, file, compress=None, origin=None): prefix = struct.pack("!HHB", self.certificate_type, self.key_tag, self.algorithm) file.write(prefix) file.write(self.certificate) @classmethod def from_wire(cls, rdclass, rdtype, wire, current, rdlen, origin=None): prefix = wire[current: current + 5].unwrap() current += 5 rdlen -= 5 if rdlen < 0: raise dns.exception.FormError (certificate_type, key_tag, algorithm) = struct.unpack("!HHB", prefix) certificate = wire[current: current + rdlen].unwrap() return cls(rdclass, rdtype, certificate_type, key_tag, algorithm, certificate) PK g\c# rdtypes/ANY/TLSA.pynu [ # Copyright (C) 2005-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. import struct import binascii import dns.rdata import dns.rdatatype class TLSA(dns.rdata.Rdata): """TLSA record @ivar usage: The certificate usage @type usage: int @ivar selector: The selector field @type selector: int @ivar mtype: The 'matching type' field @type mtype: int @ivar cert: The 'Certificate Association Data' field @type cert: string @see: RFC 6698""" __slots__ = ['usage', 'selector', 'mtype', 'cert'] def __init__(self, rdclass, rdtype, usage, selector, mtype, cert): super(TLSA, self).__init__(rdclass, rdtype) self.usage = usage self.selector = selector self.mtype = mtype self.cert = cert def to_text(self, origin=None, relativize=True, **kw): return '%d %d %d %s' % (self.usage, self.selector, self.mtype, dns.rdata._hexify(self.cert, chunksize=128)) @classmethod def from_text(cls, rdclass, rdtype, tok, origin=None, relativize=True): usage = tok.get_uint8() selector = tok.get_uint8() mtype = tok.get_uint8() cert_chunks = [] while 1: t = tok.get().unescape() if t.is_eol_or_eof(): break if not t.is_identifier(): raise dns.exception.SyntaxError cert_chunks.append(t.value.encode()) cert = b''.join(cert_chunks) cert = binascii.unhexlify(cert) return cls(rdclass, rdtype, usage, selector, mtype, cert) def to_wire(self, file, compress=None, origin=None): header = struct.pack("!BBB", self.usage, self.selector, self.mtype) file.write(header) file.write(self.cert) @classmethod def from_wire(cls, rdclass, rdtype, wire, current, rdlen, origin=None): header = struct.unpack("!BBB", wire[current: current + 3]) current += 3 rdlen -= 3 cert = wire[current: current + rdlen].unwrap() return cls(rdclass, rdtype, header[0], header[1], header[2], cert) PK g\j/jk k * rdtypes/ANY/__pycache__/LOC.cpython-36.pycnu [ 3 bW/ @ s d dl mZ d dlZd dlZd dlZd dlmZmZm Z e dd e d dD Z dZ dZd Zd d Zd d Zdd Zdd Zdd ZG dd dejjZdS ) )divisionN)longxrangeround_py2_compatc c s | ]}t d | V qdS ) N)r ).0i r /usr/lib/python3.6/LOC.py <genexpr> s r g Y@g .Ag @@c C sh | dkr dS d }x2t ttD ]"}| t| tdkr |d }P q W |d ksT|dk rdtjjd| |S )Nr z%s value out of bounds)r len_powsr dns exception SyntaxError)whatdescZexpr r r r _exponent_of! s r c C s | dk rd}| d9 } nd}t | d } t| d }| |d 8 } t| d }| |d 8 } t| d }| t|d 8 } t| } |||| |fS )Nr r i6 i` i r )r int)r ZsignZdegreesZminutessecondsr r r _float_to_tuple. s r c C sX t | d }|t | d d 7 }|t | d d 7 }|t | d d 7 }t | d | S ) Nr r g N@ g @ g @wKA )float)r valuer r r _tuple_to_float? s r c C s4 t | } t| |d@ }| td| d@ }|d | S )N r )r r pow)r r exponentbaser r r _encode_sizeG s r% c C sV | d@ }|dkr t jjd| | d@ d? }|dkrDt jjd| t|td| S )Nr zbad %s exponent r z bad %s baser )r r r r r" )r r r# r$ r r r _decode_sizeN s r( c s e Zd ZdZddddddgZeeef fdd Zd d d Z e d ddZ d!ddZ e d"ddZ dd Zdd ZeeeddZdd Zd d Zeeed dZ ZS )#LOCa LOC record @ivar latitude: latitude @type latitude: (int, int, int, int, sign) tuple specifying the degrees, minutes, seconds, milliseconds, and sign of the coordinate. @ivar longitude: longitude @type longitude: (int, int, int, int, sign) tuple specifying the degrees, minutes, seconds, milliseconds, and sign of the coordinate. @ivar altitude: altitude @type altitude: float @ivar size: size of the sphere @type size: float @ivar horizontal_precision: horizontal precision @type horizontal_precision: float @ivar vertical_precision: vertical precision @type vertical_precision: float @see: RFC 1876latitude longitudealtitudesizehorizontal_precisionvertical_precisionc s t t| j|| t|ts&t|tr.t|}t|tr@t|}|| _t|tsZt|trbt|}t|trtt|}|| _ t|| _ t|| _ t|| _ t|| _ dS )a Initialize a LOC record instance. The parameters I{latitude} and I{longitude} may be either a 4-tuple of integers specifying (degrees, minutes, seconds, milliseconds), or they may be floating point values specifying the number of degrees. The other parameters are floats. Size, horizontal precision, and vertical precision are specified in centimeters.N)superr) __init__ isinstancer r r r r* r+ r, r- r. r/ ) selfrdclassrdtyper* r+ r, r- hprecvprec) __class__r r r1 o s z LOC.__init__NTc K s | j d dkrd}nd}| jd dkr,d}nd}d| j d | j d | j d | j d || jd | jd | jd | jd || jd f }| jtks| jtks| jtkr|d | jd | jd | jd f 7 }|S ) Nr r NSEWz(%d %d %d.%03d %s %d %d %d.%03d %s %0.2fmr r r g Y@z %0.2fm %0.2fm %0.2fm) r* r+ r, r- _default_sizer. _default_hprecr/ _default_vprec)r3 origin relativizekwZlat_hemisphereZlong_hemispheretextr r r to_text s& z LOC.to_textc C s dddddg}dddddg}t }t} t} |j |d< |j } | j r0t| |d< |j } d| kr| jd\} } | j stj j dt| |d< |d dkrtj j dt | }|dks|dks| j rtj j d |dkrd }n|dkrd }nd}|t| |d< |j } n | j r0t| |d< |j } | d krDd|d < n| dkrZtj j d|j |d< |j } | j rpt| |d< |j } d| krR| jd\} } | j stj j dt| |d< |d dkrtj j dt | }|dks|dks| j rtj j d|dkr$d }n|dkr4d }nd}|t| |d< |j } n | j rpt| |d< |j } | dkrd|d < n| dkrtj j d|j } | d dkr| dd } t | d }|j j }|j s|j}|d dkr|dd }t |d }|j j }|j s|j}|d dkr@|dd }t |d } |j j }|j s|j}|d dkr|dd! }t |d } |j | ||||||| | S )"Nr r .zbad latitude seconds valuer < zlatitude seconds >= 60r z bad latitude milliseconds valued r r: r r9 z bad latitude hemisphere valuezbad longitude seconds valuezlongitude seconds >= 60z bad longitude milliseconds valuer< r; z bad longitude hemisphere valuemg Y@r r r r r r r r r r )r= r> r? Zget_intZ get_stringisdigitr splitr r r r r getZunescapeZ is_eol_or_eofr Zget_eol)clsr4 r5 tokr@ rA r* r+ r- r6 r7 tr millisecondslrH r, tokenr r r r from_text s z LOC.from_textc C s | j d d | j d d | j d d | j d | j d }td | }| jd d | jd d | jd d | jd | jd }td | }t| jtd }t| jd }t| jd } t| jd } tj dd|| | |||} |j | d S )Nr i6 r i` r i r r l i r- zhorizontal precisionzvertical precisionz!BBBBIII) r* r r+ r, r% r- r. r/ structpackwrite) r3 filecompressr@ rO r* r+ r, r- r6 r7 wirer r r to_wire s ( ( z LOC.to_wirec C s t jd|||| \}}} } } } } | tdkrHt| td d } nd ttd| d } | dk sp| dkr|tjjd| tdkrt| td d } ndttd| d } | dk s| dkrtjjdt| d } t|d }t| d } t| d } | ||| | | || | S )Nz!BBBBIIIl i6 r g V@z bad latitudeg f@z bad longitudeg cAr- zhorizontal precisionzvertical precisionr g Vr g f)rS unpackr r r r Z FormErrorr( )rL r4 r5 rX ZcurrentZrdlenr@ versionr- r6 r7 r* r+ r, r r r from_wire s" & z LOC.from_wirec C s t | jS )N)r r* )r3 r r r _get_float_latitude5 s zLOC._get_float_latitudec C s t || _d S )N)r r* )r3 r r r r _set_float_latitude8 s zLOC._set_float_latitudez"latitude as a floating point value)docc C s t | jS )N)r r+ )r3 r r r _get_float_longitude> s zLOC._get_float_longitudec C s t || _d S )N)r r+ )r3 r r r r _set_float_longitudeA s zLOC._set_float_longitudez#longitude as a floating point value)NT)NT)NN)N)__name__ __module__ __qualname____doc__ __slots__r= r> r? r1 rD classmethodrR rY r\ r] r^ propertyZfloat_latituder` ra Zfloat_longitude __classcell__r r )r8 r r) X s& e r) )Z __future__r rS Z dns.exceptionr Z dns.rdataZ dns._compatr r r tupleranger r= r> r? r r r r% r( ZrdataZRdatar) r r r r <module> s PK g\ޑ j 1 rdtypes/ANY/__pycache__/ISDN.cpython-36.opt-1.pycnu [ 3 bW @ sD d dl Z d dlZd dlZd dlZd dlmZ G dd dejjZ dS ) N) text_typec sX e Zd ZdZddgZ fddZddd Zedd d Zdd d Z edddZ Z S )ISDNzISDN record @ivar address: the ISDN address @type address: string @ivar subaddress: the ISDN subaddress (or '' if not present) @type subaddress: string @see: RFC 1183address subaddressc sN t t| j|| t|tr(|j | _n|| _t|trD|j | _n|| _d S )N)superr __init__ isinstancer encoder r )selfrdclassrdtyper r ) __class__ /usr/lib/python3.6/ISDN.pyr $ s z ISDN.__init__NTc K s< | j r&dtjj| jtjj| j f S dtjj| j S d S )Nz "%s" "%s"z"%s")r dnsrdataZ _escapifyr )r origin relativizekwr r r to_text/ s z ISDN.to_textc C sP |j }|j }|j s,|j| |j }n|j| d}|j | ||||S )N )Z get_stringgetZ is_eol_or_eofZungetZget_eol) clsr r tokr r r tr r r r from_text6 s zISDN.from_textc C s\ t | j}|jtjd| |j| j t | j}|dkrX|jtjd| |j| j d S )Nz!Br )lenr writestructpackr )r filecompressr lr r r to_wireC s z ISDN.to_wirec C s || }|d7 }|d8 }||kr(t jj|||| j }||7 }||8 }|dkr|| }|d7 }|d8 }||kr|t jj|||| j } nd} | |||| S )N r r )r Z exceptionZ FormErrorZunwrap) r r r ZwireZcurrentZrdlenr r" r r r r r from_wireN s" zISDN.from_wire)NT)NT)NN)N) __name__ __module__ __qualname____doc__ __slots__r r classmethodr r# r% __classcell__r r )r r r s r ) r Z dns.exceptionr Z dns.rdataZ dns.tokenizerZ dns._compatr r ZRdatar r r r r <module> s PK g\[ [QX X / rdtypes/ANY/__pycache__/NS.cpython-36.opt-1.pycnu [ 3 bWi @ s" d dl ZG dd dejjjZdS ) Nc @ s e Zd ZdZdS )NSz NS recordN)__name__ __module__ __qualname____doc__ r r /usr/lib/python3.6/NS.pyr s r )Zdns.rdtypes.nsbaseZdnsZrdtypesZnsbaseZNSBaser r r r r <module> s PK g\w- , rdtypes/ANY/__pycache__/EUI48.cpython-36.pycnu [ 3 bWd @ s" d dl ZG dd dejjjZdS ) Nc @ s e Zd ZdZdZed d ZdS )EUI48zEUI48 record @ivar fingerprint: 48-bit Extended Unique Identifier (EUI-48) @type fingerprint: string @see: rfc7043.txt N)__name__ __module__ __qualname____doc__Zbyte_lenZtext_len r r /usr/lib/python3.6/EUI48.pyr s r )Zdns.rdtypes.euibaseZdnsZrdtypesZeuibaseZEUIBaser r r r r <module> s PK g\u[ [ , rdtypes/ANY/__pycache__/SSHFP.cpython-36.pycnu [ 3 bW @ s8 d dl Z d dlZd dlZd dlZG dd dejjZdS ) Nc sZ e Zd ZdZdddgZ fddZdd d Zedd d Zdd dZ edddZ Z S )SSHFPzSSHFP record @ivar algorithm: the algorithm @type algorithm: int @ivar fp_type: the digest type @type fp_type: int @ivar fingerprint: the fingerprint @type fingerprint: string @see: draft-ietf-secsh-dns-05.txt algorithmfp_type fingerprintc s( t t| j|| || _|| _|| _d S )N)superr __init__r r r )selfrdclassrdtyper r r ) __class__ /usr/lib/python3.6/SSHFP.pyr % s zSSHFP.__init__NTc K s d| j | jtjj| jddf S )Nz%d %d %s )Z chunksize)r r dnsrdataZ_hexifyr )r origin relativizekwr r r to_text, s z SSHFP.to_textc C st |j }|j }g }x:|j j } | j r,P | j s<tjj|j| j j qW dj |} t j | } | ||||| S )N )Z get_uint8getZunescapeZ is_eol_or_eofZ is_identifierr Z exception SyntaxErrorappendvalueencodejoinbinasciiZ unhexlify) clsr r tokr r r r Zchunkstr r r r from_text2 s zSSHFP.from_textc C s, t jd| j| j}|j| |j| j d S )Nz!BB)structpackr r writer )r filecompressr headerr r r to_wireB s z SSHFP.to_wirec C sT t jd|||d }|d7 }|d8 }|||| j }| |||d |d |S )Nz!BB r )r! unpackZunwrap) r r r ZwireZcurrentZrdlenr r& r r r r from_wireG s zSSHFP.from_wire)NT)NT)NN)N) __name__ __module__ __qualname____doc__ __slots__r r classmethodr r' r+ __classcell__r r )r r r s r )r! r Z dns.rdatar Z dns.rdatatyper ZRdatar r r r r <module> s PK g\oDB 2 rdtypes/ANY/__pycache__/HINFO.cpython-36.opt-1.pycnu [ 3 bWi @ sD d dl Z d dlZd dlZd dlZd dlmZ G dd dejjZ dS ) N) text_typec sX e Zd ZdZddgZ fddZddd Zedd d Zdd d Z edddZ Z S )HINFOzHINFO record @ivar cpu: the CPU type @type cpu: string @ivar os: the OS type @type os: string @see: RFC 1035cpuosc sN t t| j|| t|tr(|j | _n|| _t|trD|j | _n|| _d S )N)superr __init__ isinstancer encoder r )selfrdclassrdtyper r ) __class__ /usr/lib/python3.6/HINFO.pyr $ s zHINFO.__init__NTc K s dt jj| jt jj| jf S )Nz "%s" "%s")dnsrdataZ _escapifyr r )r origin relativizekwr r r to_text/ s z HINFO.to_textc C s& |j }|j }|j | ||||S )N)Z get_stringZget_eol)clsr r tokr r r r r r r from_text3 s zHINFO.from_textc C sT t | j}|jtjd| |j| j t | j}|jtjd| |j| j d S )Nz!B)lenr writestructpackr )r filecompressr lr r r to_wire: s z HINFO.to_wirec C s || }|d7 }|d8 }||kr(t jj|||| j }||7 }||8 }|| }|d7 }|d8 }||krtt jj|||| j } | |||| S )N )r Z exceptionZ FormErrorZunwrap) r r r ZwireZcurrentZrdlenr r r r r r r from_wireD s zHINFO.from_wire)NT)NT)NN)N) __name__ __module__ __qualname____doc__ __slots__r r classmethodr r r" __classcell__r r )r r r s r ) r Z dns.exceptionr Z dns.rdataZ dns.tokenizerZ dns._compatr r ZRdatar r r r r <module> s PK g\!F0 3 rdtypes/ANY/__pycache__/DNSKEY.cpython-36.opt-1.pycnu [ 3 bW @ s: d dl Zd dl mZmZ ddgZG dd dejjjZdS ) N)flags_to_text_setflags_from_text_setr r c @ s e Zd ZdZdS )DNSKEYz DNSKEY recordN)__name__ __module__ __qualname____doc__ r r /usr/lib/python3.6/DNSKEY.pyr s r ) Zdns.rdtypes.dnskeybaseZdnsr r __all__ZrdtypesZ dnskeybaseZ DNSKEYBaser r r r r <module> s PK g\ 1 rdtypes/ANY/__pycache__/TLSA.cpython-36.opt-1.pycnu [ 3 bW @ s8 d dl Z d dlZd dlZd dlZG dd dejjZdS ) Nc s\ e Zd ZdZddddgZ fddZdd d Zedd d ZdddZ edddZ Z S )TLSAa* TLSA record @ivar usage: The certificate usage @type usage: int @ivar selector: The selector field @type selector: int @ivar mtype: The 'matching type' field @type mtype: int @ivar cert: The 'Certificate Association Data' field @type cert: string @see: RFC 6698usageselectormtypecertc s. t t| j|| || _|| _|| _|| _d S )N)superr __init__r r r r )selfrdclassrdtyper r r r ) __class__ /usr/lib/python3.6/TLSA.pyr ' s z TLSA.__init__NTc K s$ d| j | j| jtjj| jddf S )Nz %d %d %d %s )Z chunksize)r r r dnsrdataZ_hexifyr )r origin relativizekwr r r to_text/ s z TLSA.to_textc C s~ |j }|j }|j }g } x:|j j } | j r4P | j sDtjj| j| j j q W dj | } t j | } | |||||| S )N )Z get_uint8getZunescapeZ is_eol_or_eofZ is_identifierr Z exception SyntaxErrorappendvalueencodejoinbinasciiZ unhexlify) clsr r tokr r r r r Z cert_chunkstr r r r from_text6 s zTLSA.from_textc C s0 t jd| j| j| j}|j| |j| j d S )Nz!BBB)structpackr r r writer )r filecompressr headerr r r to_wireG s z TLSA.to_wirec C sZ t jd|||d }|d7 }|d8 }|||| j }| |||d |d |d |S )Nz!BBB r )r" unpackZunwrap) r r r ZwireZcurrentZrdlenr r' r r r r from_wireL s zTLSA.from_wire)NT)NT)NN)N) __name__ __module__ __qualname____doc__ __slots__r r classmethodr! r( r- __classcell__r r )r r r s r )r" r Z dns.rdatar Z dns.rdatatyper ZRdatar r r r r <module> s PK g\j+ 1 rdtypes/ANY/__pycache__/CERT.cpython-36.opt-1.pycnu [ 3 bWo @ sx d dl Z d dlZd dlZd dlZd dlZd dlZddddddZdd d d d d Zdd Z dd Z G dd dej j Z dS ) NPKIXSPKIPGPURIOID) r r r r r )r r r r r c C s t j| }|d k r|S t| S )N)_ctype_by_namegetint)whatv r /usr/lib/python3.6/CERT.py_ctype_from_text) s r c C s t j| }|d k r|S t| S )N)_ctype_by_valuer str)r r r r r _ctype_to_text0 s r c s\ e Zd ZdZddddgZ fddZdd d Zedd d ZdddZ edddZ Z S )CERTa" CERT record @ivar certificate_type: certificate type @type certificate_type: int @ivar key_tag: key tag @type key_tag: int @ivar algorithm: algorithm @type algorithm: int @ivar certificate: the certificate or CRL @type certificate: string @see: RFC 2538certificate_typekey_tag algorithm certificatec s. t t| j|| || _|| _|| _|| _d S )N)superr __init__r r r r )selfrdclassrdtyper r r r ) __class__r r r G s z CERT.__init__NTc K s0 t | j}d|| jtjj| jtjj| j f S )Nz %s %d %s %s) r r r dnsdnssecZalgorithm_to_textr rdataZ _base64ifyr )r origin relativizekwr r r r to_textO s z CERT.to_textc C s t |j }|j }tjj|j }|dk s4|dkr@tjjdg } x:|j j } | j r\P | j sltjj| j | j j qFW dj| } tj| } | |||||| S )Nr zbad algorithm type )r Z get_stringZ get_uint16r" r# Zalgorithm_from_text exception SyntaxErrorr ZunescapeZ is_eol_or_eofZ is_identifierappendvalueencodejoinbase64Z b64decode) clsr r tokr% r& r r r ZchunkstZb64r r r r from_textU s" zCERT.from_textc C s0 t jd| j| j| j}|j| |j| j d S )Nz!HHB)structpackr r r writer )r filecompressr% prefixr r r to_wirei s z CERT.to_wirec C sl |||d j }|d7 }|d8 }|dk r4tjjtjd|\}} } |||| j } | |||| | | S )N r z!HHB)Zunwrapr" r+ Z FormErrorr6 unpack) r2 r r ZwireZcurrentZrdlenr% r; r r r r r r r from_wireo s zCERT.from_wire)NT)NT)NN)N) __name__ __module__ __qualname____doc__ __slots__r r( classmethodr5 r< r? __classcell__r r )r! r r 7 s r )r6 r1 Z dns.exceptionr" Z dns.dnssecZ dns.rdataZ dns.tokenizerr r r r r$ ZRdatar r r r r <module> s$ PK g\ 0 rdtypes/ANY/__pycache__/X25.cpython-36.opt-1.pycnu [ 3 bWG @ sD d dl Z d dlZd dlZd dlZd dlmZ G dd dejjZ dS ) N) text_typec sV e Zd ZdZdgZ fddZdddZedd d Zdd d Z edd dZ Z S )X25z\X25 record @ivar address: the PSDN address @type address: string @see: RFC 1183addressc s2 t t| j|| t|tr(|j | _n|| _d S )N)superr __init__ isinstancer encoder )selfrdclassrdtyper ) __class__ /usr/lib/python3.6/X25.pyr " s z X25.__init__NTc K s dt jj| j S )Nz"%s")dnsrdataZ _escapifyr )r origin relativizekwr r r to_text) s z X25.to_textc C s |j }|j | |||S )N)Z get_stringZget_eol)clsr r tokr r r r r r from_text, s z X25.from_textc C s, t | j}|jtjd| |j| j d S )Nz!B)lenr writestructpack)r filecompressr lr r r to_wire2 s z X25.to_wirec C sH || }|d7 }|d8 }||kr(t jj|||| j }| |||S )N )r Z exceptionZ FormErrorZunwrap) r r r ZwireZcurrentZrdlenr r r r r r from_wire8 s z X25.from_wire)NT)NT)NN)N) __name__ __module__ __qualname____doc__ __slots__r r classmethodr r r! __classcell__r r )r r r s r ) r Z dns.exceptionr Z dns.rdataZ dns.tokenizerZ dns._compatr r ZRdatar r r r r <module> s PK g\T/[ [ 0 rdtypes/ANY/__pycache__/CDS.cpython-36.opt-1.pycnu [ 3 bWk @ s" d dl ZG dd dejjjZdS ) Nc @ s e Zd ZdZdS )CDSz CDS recordN)__name__ __module__ __qualname____doc__ r r /usr/lib/python3.6/CDS.pyr s r )Zdns.rdtypes.dsbaseZdnsZrdtypesZdsbaseZDSBaser r r r r <module> s PK g\ , rdtypes/ANY/__pycache__/EUI64.cpython-36.pycnu [ 3 bWn @ s" d dl ZG dd dejjjZdS ) Nc @ s e Zd ZdZdZed d ZdS )EUI64zEUI64 record @ivar fingerprint: 64-bit Extended Unique Identifier (EUI-64) @type fingerprint: string @see: rfc7043.txt N)__name__ __module__ __qualname____doc__Zbyte_lenZtext_len r r /usr/lib/python3.6/EUI64.pyr s r )Zdns.rdtypes.euibaseZdnsZrdtypesZeuibaseZEUIBaser r r r r <module> s PK g\ { 2 rdtypes/ANY/__pycache__/NSEC3.cpython-36.opt-1.pycnu [ 3 bW @ s d dl Z d dlZd dlZd dlZd dlZd dlZd dlZd dlm Z m Z y ej ddZ ej ddZ W n, ek r ej ddZ ej ddZ Y nX dZdZG dd d ejjZdS ) N)xrange text_typeZ 0123456789ABCDEFGHIJKLMNOPQRSTUVZ ABCDEFGHIJKLMNOPQRSTUVWXYZ234567s 0123456789ABCDEFGHIJKLMNOPQRSTUVs ABCDEFGHIJKLMNOPQRSTUVWXYZ234567 c s` e Zd ZdZddddddgZ fdd Zdd d ZedddZdddZ edddZ Z S )NSEC3a NSEC3 record @ivar algorithm: the hash algorithm number @type algorithm: int @ivar flags: the flags @type flags: int @ivar iterations: the number of iterations @type iterations: int @ivar salt: the salt @type salt: string @ivar next: the next name hash @type next: string @ivar windows: the windowed bitmap list @type windows: list of (window number, string) tuples algorithmflags iterationssaltnextwindowsc sP t t| j|| || _|| _|| _t|tr:|j | _ n|| _ || _ || _ d S )N) superr __init__r r r isinstancer encoder r r ) selfrdclassrdtyper r r r r r ) __class__ /usr/lib/python3.6/NSEC3.pyr ? s zNSEC3.__init__NTc K s t j| jjtj j }| jdkr*d}ntj | jj }d}x| j D ]\}}g } x`t dt |D ]N} || } x@t ddD ]2} | d| ? @ rz| j tjj|d | d | qzW qbW |ddj| 7 }qFW d | j| j| j|||f S ) N - r z%u %u %u %s %s%s)base64Z b32encoder translateb32_normal_to_hexlowerdecoder binasciiZhexlifyr r lenappenddns rdatatypeto_textjoinr r r ) r origin relativizekwr r textwindowbitmapbitsibytejr r r r' L s" z NSEC3.to_textc C s |j }|j }|j }|j } | dkr.d} ntj| jd} |j jdj jt} t j | } g } xZ|j j } | j r|P tjj| j} | dkrtjjd| dkrtjjd| j| qfW | j d}d}d}tdd }g }x| D ]} | |krq| }| d }||krD|dkr4|j|d j|d| f tdd }|}| d }|d }|d }|d }|| d|? B ||< qW |dkr|j||d| f | |||||| | |S )Nr r asciir zNSEC3 with bit 0i zNSEC3 with bit > 65535 r r r r r )Z get_uint8Z get_uint16Z get_stringr" Z unhexlifyr upperr b32_hex_to_normalr Z b32decodegetZunescapeZ is_eol_or_eofr% r& from_textvalue exception SyntaxErrorr$ sort bytearrayr( )clsr r tokr) r* r r r r r ZrdtypestokenZnrdtyper- octetsZ prior_rdtyper. r Z new_windowoffsetr1 bitr r r r9 ` s\ zNSEC3.from_textc C s t | j}|jtjd| j| j| j| |j| j t | j}|jtjd| |j| j x4| j D ]*\}}|jtjd|t | |j| qdW d S )Nz!BBHBz!Bz!BB) r# r writestructpackr r r r r )r filecompressr) lr- r. r r r to_wire s z NSEC3.to_wirec C sZ t jd|||d \}}} } |d7 }|d8 }|||| j } || 7 }|| 8 }|| } |d7 }|d8 }|||| j } || 7 }|| 8 }g }x|dkrB|dk rtjjd|| }||d }|dks|dkrtjjd|d 7 }|d 8 }||k r tjjd t|||| j }||7 }||8 }|j||f qW | ||||| | | |S ) Nz!BBHB r r zNSEC3 too shortr5 zbad NSEC3 octets zbad NSEC3 bitmap length)rF unpackZunwrapr% r; Z FormErrorr> r$ )r? r r ZwireZcurrentZrdlenr) r r r Zslenr Znlenr r r- rB r. r r r from_wire s< zNSEC3.from_wire)NT)NT)NN)N) __name__ __module__ __qualname____doc__ __slots__r r' classmethodr9 rK rP __classcell__r r )r r r , s 1 r )r r" stringrF Z dns.exceptionr% Z dns.rdataZ dns.rdatatypeZ dns._compatr r maketransr7 r AttributeErrorbytesZSHA1ZOPTOUTZrdataZRdatar r r r r <module> s( PK g\!F0 - rdtypes/ANY/__pycache__/DNSKEY.cpython-36.pycnu [ 3 bW @ s: d dl Zd dl mZmZ ddgZG dd dejjjZdS ) N)flags_to_text_setflags_from_text_setr r c @ s e Zd ZdZdS )DNSKEYz DNSKEY recordN)__name__ __module__ __qualname____doc__ r r /usr/lib/python3.6/DNSKEY.pyr s r ) Zdns.rdtypes.dnskeybaseZdnsr r __all__ZrdtypesZ dnskeybaseZ DNSKEYBaser r r r r <module> s PK g\?rj j / rdtypes/ANY/__pycache__/RT.cpython-36.opt-1.pycnu [ 3 bW{ @ s" d dl ZG dd dejjjZdS ) Nc @ s e Zd ZdZdS )RTz RT recordN)__name__ __module__ __qualname____doc__ r r /usr/lib/python3.6/RT.pyr s r )Zdns.rdtypes.mxbaseZdnsZrdtypesZmxbaseZUncompressedDowncasingMXr r r r r <module> s PK g\[ [QX X ) rdtypes/ANY/__pycache__/NS.cpython-36.pycnu [ 3 bWi @ s" d dl ZG dd dejjjZdS ) Nc @ s e Zd ZdZdS )NSz NS recordN)__name__ __module__ __qualname____doc__ r r /usr/lib/python3.6/NS.pyr s r )Zdns.rdtypes.nsbaseZdnsZrdtypesZnsbaseZNSBaser r r r r <module> s PK g\ . rdtypes/ANY/__pycache__/CDNSKEY.cpython-36.pycnu [ 3 bW @ s: d dl Zd dl mZmZ ddgZG dd dejjjZdS ) N)flags_to_text_setflags_from_text_setr r c @ s e Zd ZdZdS )CDNSKEYzCDNSKEY recordN)__name__ __module__ __qualname____doc__ r r /usr/lib/python3.6/CDNSKEY.pyr s r ) Zdns.rdtypes.dnskeybaseZdnsr r __all__ZrdtypesZ dnskeybaseZ DNSKEYBaser r r r r <module> s PK g\u[ [ 2 rdtypes/ANY/__pycache__/SSHFP.cpython-36.opt-1.pycnu [ 3 bW @ s8 d dl Z d dlZd dlZd dlZG dd dejjZdS ) Nc sZ e Zd ZdZdddgZ fddZdd d Zedd d Zdd dZ edddZ Z S )SSHFPzSSHFP record @ivar algorithm: the algorithm @type algorithm: int @ivar fp_type: the digest type @type fp_type: int @ivar fingerprint: the fingerprint @type fingerprint: string @see: draft-ietf-secsh-dns-05.txt algorithmfp_type fingerprintc s( t t| j|| || _|| _|| _d S )N)superr __init__r r r )selfrdclassrdtyper r r ) __class__ /usr/lib/python3.6/SSHFP.pyr % s zSSHFP.__init__NTc K s d| j | jtjj| jddf S )Nz%d %d %s )Z chunksize)r r dnsrdataZ_hexifyr )r origin relativizekwr r r to_text, s z SSHFP.to_textc C st |j }|j }g }x:|j j } | j r,P | j s<tjj|j| j j qW dj |} t j | } | ||||| S )N )Z get_uint8getZunescapeZ is_eol_or_eofZ is_identifierr Z exception SyntaxErrorappendvalueencodejoinbinasciiZ unhexlify) clsr r tokr r r r Zchunkstr r r r from_text2 s zSSHFP.from_textc C s, t jd| j| j}|j| |j| j d S )Nz!BB)structpackr r writer )r filecompressr headerr r r to_wireB s z SSHFP.to_wirec C sT t jd|||d }|d7 }|d8 }|||| j }| |||d |d |S )Nz!BB r )r! unpackZunwrap) r r r ZwireZcurrentZrdlenr r& r r r r from_wireG s zSSHFP.from_wire)NT)NT)NN)N) __name__ __module__ __qualname____doc__ __slots__r r classmethodr r' r+ __classcell__r r )r r r s r )r! r Z dns.rdatar Z dns.rdatatyper ZRdatar r r r r <module> s PK g\!s 2 rdtypes/ANY/__pycache__/DNAME.cpython-36.opt-1.pycnu [ 3 bW @ s" d dl ZG dd dejjjZdS ) Nc @ s e Zd ZdZdddZdS )DNAMEz DNAME recordNc C s | j j|S )N)target to_digestable)selforigin r /usr/lib/python3.6/DNAME.pyr s zDNAME.to_digestable)N)__name__ __module__ __qualname____doc__r r r r r r s r )Zdns.rdtypes.nsbaseZdnsZrdtypesZnsbaseZUncompressedNSr r r r r <module> s PK g\UXTX X ) rdtypes/ANY/__pycache__/DS.cpython-36.pycnu [ 3 bWi @ s" d dl ZG dd dejjjZdS ) Nc @ s e Zd ZdZdS )DSz DS recordN)__name__ __module__ __qualname____doc__ r r /usr/lib/python3.6/DS.pyr s r )Zdns.rdtypes.dsbaseZdnsZrdtypesZdsbaseZDSBaser r r r r <module> s PK g\ + rdtypes/ANY/__pycache__/TLSA.cpython-36.pycnu [ 3 bW @ s8 d dl Z d dlZd dlZd dlZG dd dejjZdS ) Nc s\ e Zd ZdZddddgZ fddZdd d Zedd d ZdddZ edddZ Z S )TLSAa* TLSA record @ivar usage: The certificate usage @type usage: int @ivar selector: The selector field @type selector: int @ivar mtype: The 'matching type' field @type mtype: int @ivar cert: The 'Certificate Association Data' field @type cert: string @see: RFC 6698usageselectormtypecertc s. t t| j|| || _|| _|| _|| _d S )N)superr __init__r r r r )selfrdclassrdtyper r r r ) __class__ /usr/lib/python3.6/TLSA.pyr ' s z TLSA.__init__NTc K s$ d| j | j| jtjj| jddf S )Nz %d %d %d %s )Z chunksize)r r r dnsrdataZ_hexifyr )r origin relativizekwr r r to_text/ s z TLSA.to_textc C s~ |j }|j }|j }g } x:|j j } | j r4P | j sDtjj| j| j j q W dj | } t j | } | |||||| S )N )Z get_uint8getZunescapeZ is_eol_or_eofZ is_identifierr Z exception SyntaxErrorappendvalueencodejoinbinasciiZ unhexlify) clsr r tokr r r r r Z cert_chunkstr r r r from_text6 s zTLSA.from_textc C s0 t jd| j| j| j}|j| |j| j d S )Nz!BBB)structpackr r r writer )r filecompressr headerr r r to_wireG s z TLSA.to_wirec C sZ t jd|||d }|d7 }|d8 }|||| j }| |||d |d |d |S )Nz!BBB r )r" unpackZunwrap) r r r ZwireZcurrentZrdlenr r' r r r r from_wireL s zTLSA.from_wire)NT)NT)NN)N) __name__ __module__ __qualname____doc__ __slots__r r classmethodr! r( r- __classcell__r r )r r r s r )r" r Z dns.rdatar Z dns.rdatatyper ZRdatar r r r r <module> s PK g\> * rdtypes/ANY/__pycache__/AVC.cpython-36.pycnu [ 3 ӓW @ s" d dl ZG dd dejjjZdS ) Nc @ s e Zd ZdZdS )AVCzbAVC record @see: U{http://www.iana.org/assignments/dns-parameters/AVC/avc-completed-template}N)__name__ __module__ __qualname____doc__ r r /usr/lib/python3.6/AVC.pyr s r )Zdns.rdtypes.txtbaseZdnsZrdtypesZtxtbaseZTXTBaser r r r r <module> s PK g\_ _ 2 rdtypes/ANY/__pycache__/RRSIG.cpython-36.opt-1.pycnu [ 3 bW @ s| d dl Z d dlZd dlZd dlZd dlZd dlZd dlZd dlZG dd dej j Z dd Z dd Z G dd d ejjZdS ) Nc @ s e Zd ZdZdS ) BadSigTimez:Time in DNS SIG or RRSIG resource record cannot be parsed.N)__name__ __module__ __qualname____doc__ r r /usr/lib/python3.6/RRSIG.pyr s r c C s t | dkrtt| dd }t| dd }t| dd }t| dd }t| dd }t| dd }tj||||||dddf S )N r )lenr intcalendarZtimegm)whatZyearZmonthZdayZhourZminutesecondr r r sigtime_to_posixtime s r c C s t jdt j| S )Nz %Y%m%d%H%M%S)timeZstrftimeZgmtime)r r r r posixtime_to_sigtime- s r c sx e Zd ZdZdddddddd d g Z fd d Zd d ZdddZed ddZ d ddZ ed ddZ d ddZ Z S ) RRSIGa~ RRSIG record @ivar type_covered: the rdata type this signature covers @type type_covered: int @ivar algorithm: the algorithm used for the sig @type algorithm: int @ivar labels: number of labels @type labels: int @ivar original_ttl: the original TTL @type original_ttl: long @ivar expiration: signature expiration time @type expiration: long @ivar inception: signature inception time @type inception: long @ivar key_tag: the key tag @type key_tag: int @ivar signer: the signer @type signer: dns.name.Name object @ivar signature: the signature @type signature: string type_covered algorithmlabels original_ttl expiration inceptionkey_tagsigner signaturec sL t t| j|| || _|| _|| _|| _|| _|| _| | _ | | _ | | _ d S )N) superr __init__r r r r r r r r r ) selfrdclassrdtyper r r r r r r r r ) __class__r r r" L s zRRSIG.__init__c C s | j S )N)r )r# r r r coversZ s z RRSIG.coversNTc K sL dt jj| j| j| j| jt| jt| j | j | j j ||t j j| jf S )Nz%s %d %d %d %s %s %d %s %s)dns rdatatypeto_textr r r r r r r r r choose_relativityrdataZ _base64ifyr )r# origin relativizekwr r r r* ] s z RRSIG.to_textc C s t jj|j }t jj|j }|j }|j } t|j } t|j } |j } |j } | j ||} g }x:|j j }|j rP |j st jj|j|jj qjW dj|}tj|}| |||||| | | | | | S )N )r( r) from_textZ get_stringZdnssecZalgorithm_from_textZget_intZget_ttlr Zget_namer+ getZunescapeZ is_eol_or_eofZ is_identifier exception SyntaxErrorappendvalueencodejoinbase64Z b64decode)clsr$ r% tokr- r. r r r r r r r r ZchunkstZb64r r r r r1 j s, zRRSIG.from_textc C sP t jd| j| j| j| j| j| j| j}|j | | j j |d | |j | j d S )Nz!HBBIIIH) structpackr r r r r r r writer to_wirer )r# filecompressr- headerr r r r@ s z RRSIG.to_wirec C s t jd|||d }|d7 }|d8 }tjj|d || |\}} || 7 }|| 8 }|d k rh|j|}|||| j } | |||d |d |d |d |d |d |d || S ) Nz!HBBIIIH r r r )r= unpackr( name from_wirer. Zunwrap) r: r$ r% ZwireZcurrentZrdlenr- rC r Zcusedr r r r rK s zRRSIG.from_wirec C s | j j||| _ d S )N)r r+ )r# r- r. r r r r+ s zRRSIG.choose_relativity)NT)NT)NN)N)NT)r r r r __slots__r" r' r* classmethodr1 r@ rK r+ __classcell__r r )r& r r 1 s r )r9 r r= r Z dns.dnssecr( Z dns.exceptionZ dns.rdataZ dns.rdatatyper3 Z DNSExceptionr r r r, ZRdatar r r r r <module> s PK g\+( ( * rdtypes/ANY/__pycache__/CAA.cpython-36.pycnu [ 3 bW> @ s8 d dl Z d dlZd dlZd dlZG dd dejjZdS ) Nc sZ e Zd ZdZdddgZ fddZdd d Zedd d Zdd dZ edddZ Z S )CAAzCAA (Certification Authority Authorization) record @ivar flags: the flags @type flags: int @ivar tag: the tag @type tag: string @ivar value: the value @type value: string @see: RFC 6844flagstagvaluec s( t t| j|| || _|| _|| _d S )N)superr __init__r r r )selfrdclassrdtyper r r ) __class__ /usr/lib/python3.6/CAA.pyr % s z CAA.__init__NTc K s$ d| j tjj| jtjj| jf S )Nz %u %s "%s")r dnsrdataZ _escapifyr r )r origin relativizekwr r r to_text+ s z CAA.to_textc C s\ |j }|j j }t|dkr,tjjd|j s@tjjd|j j }| |||||S )N z tag too longztag is not alphanumeric)Z get_uint8Z get_stringencodelenr Z exception SyntaxErrorisalnum) clsr r tokr r r r r r r r from_text0 s z CAA.from_textc C sX |j tjd| j t| j}|dk s*t|j tjd| |j | j |j | j d S )Nz!B )writestructpackr r r AssertionErrorr )r filecompressr lr r r to_wire; s z CAA.to_wirec C s\ t jd|||d \}}|d7 }|||| } ||| || d } | |||| | S )Nz!BB )r unpack) r r r ZwireZcurrentZrdlenr r r# r r r r r from_wireC s z CAA.from_wire)NT)NT)NN)N) __name__ __module__ __qualname____doc__ __slots__r r classmethodr r$ r' __classcell__r r )r r r s r )r Z dns.exceptionr Z dns.rdataZ dns.tokenizerr ZRdatar r r r r <module> s PK g\M ) rdtypes/ANY/__pycache__/RP.cpython-36.pycnu [ 3 bW @ s0 d dl Zd dlZd dlZG dd dejjZdS ) Nc sl e Zd ZdZddgZ fddZddd Zedd d Zdd d Z dddZ edddZ dddZ Z S )RPa RP record @ivar mbox: The responsible person's mailbox @type mbox: dns.name.Name object @ivar txt: The owner name of a node with TXT records, or the root name if no TXT records are associated with this RP. @type txt: dns.name.Name object @see: RFC 1183mboxtxtc s" t t| j|| || _|| _d S )N)superr __init__r r )selfrdclassrdtyper r ) __class__ /usr/lib/python3.6/RP.pyr " s z RP.__init__NTc K s0 | j j||}| jj||}dt|t|f S )Nz%s %s)r choose_relativityr str)r origin relativizekwr r r r r to_text' s z RP.to_textc C s> |j }|j }|j||}|j||}|j | ||||S )N)Zget_namer Zget_eol)clsr r tokr r r r r r r from_text, s z RP.from_textc C s$ | j j|d | | jj|d | d S )N)r to_wirer )r filecompressr r r r r 5 s z RP.to_wirec C s | j j|| jj| S )N)r to_digestabler )r r r r r r 9 s zRP.to_digestablec C s t jj|d || |\}}||7 }||8 }|dkr>t jjt jj|d || |\} }||krlt jj|d k r|j|}| j|} | |||| S )Nr )dnsname from_wireZ exceptionZ FormErrorr ) r r r ZwireZcurrentZrdlenr r Zcusedr r r r r = s z RP.from_wirec C s$ | j j||| _ | jj||| _d S )N)r r r )r r r r r r r N s zRP.choose_relativity)NT)NT)NN)N)N)NT)__name__ __module__ __qualname____doc__ __slots__r r classmethodr r r r r __classcell__r r )r r r s r )Z dns.exceptionr Z dns.rdataZdns.nameZrdataZRdatar r r r r <module> s PK g\r 1 rdtypes/ANY/__pycache__/NSEC.cpython-36.opt-1.pycnu [ 3 bWR @ sL d dl Z d dlZd dlZd dlZd dlZd dlmZ G dd dejj Z dS ) N)xrangec sb e Zd ZdZddgZ fddZddd Zedd d Zdd d Z edddZ dddZ Z S )NSECzNSEC record @ivar next: the next name @type next: dns.name.Name object @ivar windows: the windowed bitmap list @type windows: list of (window number, string) tuplesnextwindowsc s" t t| j|| || _|| _d S )N)superr __init__r r )selfrdclassrdtyper r ) __class__ /usr/lib/python3.6/NSEC.pyr $ s z NSEC.__init__NTc K s | j j||}d}x| jD ]\}}g }x`tdt|D ]N} || } x@tddD ]2} | d| ? @ rN|jtjj|d | d | qNW q6W |ddj | 7 }qW d||f S )N r z%s%s) r choose_relativityr r lenappenddns rdatatypeto_textjoin) r origin relativizekwr textwindowbitmapbitsibytejr r r r ) s z NSEC.to_textc C sB |j }|j||}g }xZ|j j }|j r0P tjj|j} | dkrRtj j d| dkrftj j d|j | qW |j d} d} d} t dd } g }x|D ]|} | | krq| } | d }|| kr|j | | d| f t dd } |} | d }|d }|d }|d } | | d |? B | |< qW |j | | d| f | ||||S ) Nr zNSEC with bit 0i zNSEC with bit > 65535 r r r )Zget_namer getZunescapeZ is_eol_or_eofr r from_textvalue exception SyntaxErrorr sort bytearray)clsr r tokr r r ZrdtypestokenZnrdtyper octetsZ prior_rdtyper r Z new_windowoffsetr" bitr r r r( 7 sF zNSEC.from_textc C sJ | j j|d | x4| jD ]*\}}|jtjd|t| |j| qW d S )Nz!BB)r to_wirer writestructpackr )r filecompressr r r r r r r4 ^ s z NSEC.to_wirec C s t jj|d || |\}}||7 }||8 }g } x|dkr|dk rPt jjd|| } ||d } | dkst| dkrt jjd|d7 }|d8 }|| k rt jjdt|||| j } || 7 }|| 8 }| j| | f q4W |d k r|j|}| |||| S ) Nr zNSEC too shortr& r% zbad NSEC octets zbad NSEC bitmap length) r name from_wirer* Z FormErrorr- Zunwrapr r ) r. r r ZwireZcurrentZrdlenr r Zcusedr r r1 r r r r r= d s, zNSEC.from_wirec C s | j j||| _ d S )N)r r )r r r r r r r } s zNSEC.choose_relativity)NT)NT)NN)N)NT) __name__ __module__ __qualname____doc__ __slots__r r classmethodr( r4 r= r __classcell__r r )r r r s & r ) r6 Z dns.exceptionr Z dns.rdataZ dns.rdatatypeZdns.nameZ dns._compatr ZrdataZRdatar r r r r <module> s PK g\UXTX X / rdtypes/ANY/__pycache__/DS.cpython-36.opt-1.pycnu [ 3 bWi @ s" d dl ZG dd dejjjZdS ) Nc @ s e Zd ZdZdS )DSz DS recordN)__name__ __module__ __qualname____doc__ r r /usr/lib/python3.6/DS.pyr s r )Zdns.rdtypes.dsbaseZdnsZrdtypesZdsbaseZDSBaser r r r r <module> s PK g\M / rdtypes/ANY/__pycache__/RP.cpython-36.opt-1.pycnu [ 3 bW @ s0 d dl Zd dlZd dlZG dd dejjZdS ) Nc sl e Zd ZdZddgZ fddZddd Zedd d Zdd d Z dddZ edddZ dddZ Z S )RPa RP record @ivar mbox: The responsible person's mailbox @type mbox: dns.name.Name object @ivar txt: The owner name of a node with TXT records, or the root name if no TXT records are associated with this RP. @type txt: dns.name.Name object @see: RFC 1183mboxtxtc s" t t| j|| || _|| _d S )N)superr __init__r r )selfrdclassrdtyper r ) __class__ /usr/lib/python3.6/RP.pyr " s z RP.__init__NTc K s0 | j j||}| jj||}dt|t|f S )Nz%s %s)r choose_relativityr str)r origin relativizekwr r r r r to_text' s z RP.to_textc C s> |j }|j }|j||}|j||}|j | ||||S )N)Zget_namer Zget_eol)clsr r tokr r r r r r r from_text, s z RP.from_textc C s$ | j j|d | | jj|d | d S )N)r to_wirer )r filecompressr r r r r 5 s z RP.to_wirec C s | j j|| jj| S )N)r to_digestabler )r r r r r r 9 s zRP.to_digestablec C s t jj|d || |\}}||7 }||8 }|dkr>t jjt jj|d || |\} }||krlt jj|d k r|j|}| j|} | |||| S )Nr )dnsname from_wireZ exceptionZ FormErrorr ) r r r ZwireZcurrentZrdlenr r Zcusedr r r r r = s z RP.from_wirec C s$ | j j||| _ | jj||| _d S )N)r r r )r r r r r r r N s zRP.choose_relativity)NT)NT)NN)N)N)NT)__name__ __module__ __qualname____doc__ __slots__r r classmethodr r r r r __classcell__r r )r r r s r )Z dns.exceptionr Z dns.rdataZdns.nameZrdataZRdatar r r r r <module> s PK g\w- 2 rdtypes/ANY/__pycache__/EUI48.cpython-36.opt-1.pycnu [ 3 bWd @ s" d dl ZG dd dejjjZdS ) Nc @ s e Zd ZdZdZed d ZdS )EUI48zEUI48 record @ivar fingerprint: 48-bit Extended Unique Identifier (EUI-48) @type fingerprint: string @see: rfc7043.txt N)__name__ __module__ __qualname____doc__Zbyte_lenZtext_len r r /usr/lib/python3.6/EUI48.pyr s r )Zdns.rdtypes.euibaseZdnsZrdtypesZeuibaseZEUIBaser r r r r <module> s PK g\.M * rdtypes/ANY/__pycache__/X25.cpython-36.pycnu [ 3 bWG @ sD d dl Z d dlZd dlZd dlZd dlmZ G dd dejjZ dS ) N) text_typec sV e Zd ZdZdgZ fddZdddZedd d Zdd d Z edd dZ Z S )X25z\X25 record @ivar address: the PSDN address @type address: string @see: RFC 1183addressc s2 t t| j|| t|tr(|j | _n|| _d S )N)superr __init__ isinstancer encoder )selfrdclassrdtyper ) __class__ /usr/lib/python3.6/X25.pyr " s z X25.__init__NTc K s dt jj| j S )Nz"%s")dnsrdataZ _escapifyr )r origin relativizekwr r r to_text) s z X25.to_textc C s |j }|j | |||S )N)Z get_stringZget_eol)clsr r tokr r r r r r from_text, s z X25.from_textc C s8 t | j}|dk st|jtjd| |j| j d S )N z!B)lenr AssertionErrorwritestructpack)r filecompressr lr r r to_wire2 s z X25.to_wirec C sH || }|d7 }|d8 }||kr(t jj|||| j }| |||S )N )r Z exceptionZ FormErrorZunwrap) r r r ZwireZcurrentZrdlenr r r r r r from_wire8 s z X25.from_wire)NT)NT)NN)N) __name__ __module__ __qualname____doc__ __slots__r r classmethodr r! r# __classcell__r r )r r r s r ) r Z dns.exceptionr Z dns.rdataZ dns.tokenizerZ dns._compatr r ZRdatar r r r r <module> s PK g\\m * rdtypes/ANY/__pycache__/HIP.cpython-36.pycnu [ 3 bW0 @ sH d dl Z d dlZd dlZd dlZd dlZd dlZG dd dejjZ dS ) Nc sf e Zd ZdZddddgZ fddZdd d Zedd d ZdddZ edddZ dddZ Z S )HIPa= HIP record @ivar hit: the host identity tag @type hit: string @ivar algorithm: the public key cryptographic algorithm @type algorithm: int @ivar key: the public key @type key: string @ivar servers: the rendezvous servers @type servers: list of dns.name.Name objects @see: RFC 5205hit algorithmkeyserversc s. t t| j|| || _|| _|| _|| _d S )N)superr __init__r r r r )selfrdclassrdtyper r r r ) __class__ /usr/lib/python3.6/HIP.pyr ) s z HIP.__init__NTc K s t j| jj }tj| jjddj }d}g }x | jD ]}|j |j || q8W t |dkrz|ddj dd |D 7 }d| j |||f S ) N r c s s | ]}|j V qd S )N)Z to_unicode).0xr r r <genexpr>8 s z HIP.to_text.<locals>.<genexpr>z %u %s %s%s)binasciiZhexlifyr decodebase64Z b64encoder replacer appendchoose_relativitylenjoinr ) r origin relativizekwr r textr serverr r r to_text0 s z HIP.to_textc C s |j }tj|j j }t|dkr2tjjdt j |j j }g } x<|j } | j r\P tj j| j|} | j|| | j| qJW | |||||| S )N z HIT too long)Z get_uint8r Z unhexlifyZ get_stringencoder dnsZ exception SyntaxErrorr Z b64decodegetZ is_eol_or_eofname from_textvaluer r ) clsr r tokr r r r r r tokenr" r r r r* ; s z HIP.from_textc C sf t | j}t | j}|jtjd|| j| |j| j |j| j x | jD ]}|j|d | qLW d S )Nz!BBH) r r r writestructpackr r to_wire)r filecompressr lhlkr" r r r r2 L s z HIP.to_wirec C s t jd|||d \}}} |d7 }|d8 }|||| j } ||7 }||8 }|||| j } || 7 }|| 8 }g } xV|dkrtjj|d || |\} }||7 }||8 }|d k r| j|} | j| q|W | ||| || | S )Nz!BBH r )r0 unpackZunwrapr& r) from_wirer r )r, r r ZwireZcurrentZrdlenr r5 r r6 r r r r" Zcusedr r r r9 U s( z HIP.from_wirec C s4 g }x$| j D ]}|j||}|j| q W || _ d S )N)r r r )r r r r r" r r r r l s zHIP.choose_relativity)NT)NT)NN)N)NT) __name__ __module__ __qualname____doc__ __slots__r r# classmethodr* r2 r9 r __classcell__r r )r r r s r ) r0 r r Z dns.exceptionr& Z dns.rdataZ dns.rdatatypeZrdataZRdatar r r r r <module> s PK g\ ab4[ [ * rdtypes/ANY/__pycache__/DLV.cpython-36.pycnu [ 3 bW` @ s" d dl ZG dd dejjjZdS ) Nc @ s e Zd ZdZdS )DLVz DLV recordN)__name__ __module__ __qualname____doc__ r r /usr/lib/python3.6/DLV.pyr s r )Zdns.rdtypes.dsbaseZdnsZrdtypesZdsbaseZDSBaser r r r r <module> s PK g\?[' 0 rdtypes/ANY/__pycache__/URI.cpython-36.opt-1.pycnu [ 3 bWR @ sD d dl Z d dlZd dlZd dlZd dlmZ G dd dejjZ dS ) N) text_typec sZ e Zd ZdZdddgZ fddZdd d Zedd d Zdd dZ edddZ Z S )URIzURI record @ivar priority: the priority @type priority: int @ivar weight: the weight @type weight: int @ivar target: the target host @type target: dns.name.Name object @see: draft-faltstrom-uri-13priorityweighttargetc sV t t| j|| || _|| _t|dk r6tjjdt |t rL|j | _ n|| _ d S )N zURI target cannot be empty) superr __init__r r lendns exception SyntaxError isinstancer encoder )selfrdclassrdtyper r r ) __class__ /usr/lib/python3.6/URI.pyr ' s z URI.__init__NTc K s d| j | j| jj f S )Nz %d %d "%s")r r r decode)r origin relativizekwr r r to_text2 s z URI.to_textc C sR |j }|j }|j j }|j p*|j s8tjjd|j | |||||j S )NzURI target must be a string) Z get_uint16getZunescapeZis_quoted_stringZ is_identifierr r r Zget_eolvalue) clsr r tokr r r r r r r r from_text6 s z URI.from_textc C s, t jd| j| j}|j| |j| j d S )Nz!HH)structpackr r writer )r filecompressr Ztwo_intsr r r to_wire@ s z URI.to_wirec C sh |dk rt jjdtjd|||d \}}|d7 }|d8 }|||| } ||7 }| ||||| S )N z URI RR is shorter than 5 octetsz!HH )r r Z FormErrorr unpack) r r r ZwireZcurrentZrdlenr r r r r r r from_wireE s z URI.from_wire)NT)NT)NN)N) __name__ __module__ __qualname____doc__ __slots__r r classmethodr r% r) __classcell__r r )r r r s r ) r Z dns.exceptionr Z dns.rdataZdns.nameZ dns._compatr ZrdataZRdatar r r r r <module> s PK g\_ _ , rdtypes/ANY/__pycache__/RRSIG.cpython-36.pycnu [ 3 bW @ s| d dl Z d dlZd dlZd dlZd dlZd dlZd dlZd dlZG dd dej j Z dd Z dd Z G dd d ejjZdS ) Nc @ s e Zd ZdZdS ) BadSigTimez:Time in DNS SIG or RRSIG resource record cannot be parsed.N)__name__ __module__ __qualname____doc__ r r /usr/lib/python3.6/RRSIG.pyr s r c C s t | dkrtt| dd }t| dd }t| dd }t| dd }t| dd }t| dd }tj||||||dddf S )N r )lenr intcalendarZtimegm)whatZyearZmonthZdayZhourZminutesecondr r r sigtime_to_posixtime s r c C s t jdt j| S )Nz %Y%m%d%H%M%S)timeZstrftimeZgmtime)r r r r posixtime_to_sigtime- s r c sx e Zd ZdZdddddddd d g Z fd d Zd d ZdddZed ddZ d ddZ ed ddZ d ddZ Z S ) RRSIGa~ RRSIG record @ivar type_covered: the rdata type this signature covers @type type_covered: int @ivar algorithm: the algorithm used for the sig @type algorithm: int @ivar labels: number of labels @type labels: int @ivar original_ttl: the original TTL @type original_ttl: long @ivar expiration: signature expiration time @type expiration: long @ivar inception: signature inception time @type inception: long @ivar key_tag: the key tag @type key_tag: int @ivar signer: the signer @type signer: dns.name.Name object @ivar signature: the signature @type signature: string type_covered algorithmlabels original_ttl expiration inceptionkey_tagsigner signaturec sL t t| j|| || _|| _|| _|| _|| _|| _| | _ | | _ | | _ d S )N) superr __init__r r r r r r r r r ) selfrdclassrdtyper r r r r r r r r ) __class__r r r" L s zRRSIG.__init__c C s | j S )N)r )r# r r r coversZ s z RRSIG.coversNTc K sL dt jj| j| j| j| jt| jt| j | j | j j ||t j j| jf S )Nz%s %d %d %d %s %s %d %s %s)dns rdatatypeto_textr r r r r r r r r choose_relativityrdataZ _base64ifyr )r# origin relativizekwr r r r* ] s z RRSIG.to_textc C s t jj|j }t jj|j }|j }|j } t|j } t|j } |j } |j } | j ||} g }x:|j j }|j rP |j st jj|j|jj qjW dj|}tj|}| |||||| | | | | | S )N )r( r) from_textZ get_stringZdnssecZalgorithm_from_textZget_intZget_ttlr Zget_namer+ getZunescapeZ is_eol_or_eofZ is_identifier exception SyntaxErrorappendvalueencodejoinbase64Z b64decode)clsr$ r% tokr- r. r r r r r r r r ZchunkstZb64r r r r r1 j s, zRRSIG.from_textc C sP t jd| j| j| j| j| j| j| j}|j | | j j |d | |j | j d S )Nz!HBBIIIH) structpackr r r r r r r writer to_wirer )r# filecompressr- headerr r r r@ s z RRSIG.to_wirec C s t jd|||d }|d7 }|d8 }tjj|d || |\}} || 7 }|| 8 }|d k rh|j|}|||| j } | |||d |d |d |d |d |d |d || S ) Nz!HBBIIIH r r r )r= unpackr( name from_wirer. Zunwrap) r: r$ r% ZwireZcurrentZrdlenr- rC r Zcusedr r r r rK s zRRSIG.from_wirec C s | j j||| _ d S )N)r r+ )r# r- r. r r r r+ s zRRSIG.choose_relativity)NT)NT)NN)N)NT)r r r r __slots__r" r' r* classmethodr1 r@ rK r+ __classcell__r r )r& r r 1 s r )r9 r r= r Z dns.dnssecr( Z dns.exceptionZ dns.rdataZ dns.rdatatyper3 Z DNSExceptionr r r r, ZRdatar r r r r <module> s PK g\#c . . 2 rdtypes/ANY/__pycache__/CNAME.cpython-36.opt-1.pycnu [ 3 bW< @ s" d dl ZG dd dejjjZdS ) Nc @ s e Zd ZdZdS )CNAMEzCNAME record Note: although CNAME is officially a singleton type, dnspython allows non-singleton CNAME rdatasets because such sets have been commonly used by BIND and other nameservers for load balancing.N)__name__ __module__ __qualname____doc__ r r /usr/lib/python3.6/CNAME.pyr s r )Zdns.rdtypes.nsbaseZdnsZrdtypesZnsbaseZNSBaser r r r r <module> s PK g\r + rdtypes/ANY/__pycache__/NSEC.cpython-36.pycnu [ 3 bWR @ sL d dl Z d dlZd dlZd dlZd dlZd dlmZ G dd dejj Z dS ) N)xrangec sb e Zd ZdZddgZ fddZddd Zedd d Zdd d Z edddZ dddZ Z S )NSECzNSEC record @ivar next: the next name @type next: dns.name.Name object @ivar windows: the windowed bitmap list @type windows: list of (window number, string) tuplesnextwindowsc s" t t| j|| || _|| _d S )N)superr __init__r r )selfrdclassrdtyper r ) __class__ /usr/lib/python3.6/NSEC.pyr $ s z NSEC.__init__NTc K s | j j||}d}x| jD ]\}}g }x`tdt|D ]N} || } x@tddD ]2} | d| ? @ rN|jtjj|d | d | qNW q6W |ddj | 7 }qW d||f S )N r z%s%s) r choose_relativityr r lenappenddns rdatatypeto_textjoin) r origin relativizekwr textwindowbitmapbitsibytejr r r r ) s z NSEC.to_textc C sB |j }|j||}g }xZ|j j }|j r0P tjj|j} | dkrRtj j d| dkrftj j d|j | qW |j d} d} d} t dd } g }x|D ]|} | | krq| } | d }|| kr|j | | d| f t dd } |} | d }|d }|d }|d } | | d |? B | |< qW |j | | d| f | ||||S ) Nr zNSEC with bit 0i zNSEC with bit > 65535 r r r )Zget_namer getZunescapeZ is_eol_or_eofr r from_textvalue exception SyntaxErrorr sort bytearray)clsr r tokr r r ZrdtypestokenZnrdtyper octetsZ prior_rdtyper r Z new_windowoffsetr" bitr r r r( 7 sF zNSEC.from_textc C sJ | j j|d | x4| jD ]*\}}|jtjd|t| |j| qW d S )Nz!BB)r to_wirer writestructpackr )r filecompressr r r r r r r4 ^ s z NSEC.to_wirec C s t jj|d || |\}}||7 }||8 }g } x|dkr|dk rPt jjd|| } ||d } | dkst| dkrt jjd|d7 }|d8 }|| k rt jjdt|||| j } || 7 }|| 8 }| j| | f q4W |d k r|j|}| |||| S ) Nr zNSEC too shortr& r% zbad NSEC octets zbad NSEC bitmap length) r name from_wirer* Z FormErrorr- Zunwrapr r ) r. r r ZwireZcurrentZrdlenr r Zcusedr r r1 r r r r r= d s, zNSEC.from_wirec C s | j j||| _ d S )N)r r )r r r r r r r } s zNSEC.choose_relativity)NT)NT)NN)N)NT) __name__ __module__ __qualname____doc__ __slots__r r classmethodr( r4 r= r __classcell__r r )r r r s & r ) r6 Z dns.exceptionr Z dns.rdataZ dns.rdatatypeZdns.nameZ dns._compatr ZrdataZRdatar r r r r <module> s PK g\Ip p , rdtypes/ANY/__pycache__/CSYNC.cpython-36.pycnu [ 3 bW$ @ sL d dl Z d dlZd dlZd dlZd dlZd dlmZ G dd dejj Z dS ) N)xrangec sZ e Zd ZdZdddgZ fddZdd d Zedd d Zdd dZ edddZ Z S )CSYNCzCSYNC record @ivar serial: the SOA serial number @type serial: int @ivar flags: the CSYNC flags @type flags: int @ivar windows: the windowed bitmap list @type windows: list of (window number, string) tuplesserialflagswindowsc s( t t| j|| || _|| _|| _d S )N)superr __init__r r r )selfrdclassrdtyper r r ) __class__ /usr/lib/python3.6/CSYNC.pyr % s zCSYNC.__init__NTc K s d}x| j D ]\}}g }x`tdt|D ]N}|| } x@tddD ]2} | d| ? @ r@|jtjj|d |d | q@W q(W |ddj| 7 }q W d| j| j |f S )N r z%d %d%s) r r lenappenddns rdatatypeto_textjoinr r ) r origin relativizekwtextwindowbitmapbitsibytejr r r r + s z CSYNC.to_textc C s@ |j }|j }g }xZ|j j } | j r,P tjj| j} | dkrNtj j d| dkrbtj j d|j | qW |j d} d} d} t dd }g }x|D ]|} | | krq| } | d }|| kr|j | |d| f t dd }|} | d }|d }|d }|d } || d |? B ||< qW |j | |d| f | |||||S ) Nr zCSYNC with bit 0i zCSYNC with bit > 65535 r r r )Z get_uint32Z get_uint16getZunescapeZ is_eol_or_eofr r from_textvalue exception SyntaxErrorr sort bytearray)clsr r tokr r r r ZrdtypestokenZnrdtyper octetsZ prior_rdtyper r Z new_windowoffsetr" bitr r r r( 8 sF zCSYNC.from_textc C sR |j tjd| j| j x4| jD ]*\}}|j tjd|t| |j | q W d S )Nz!IHz!BB)writestructpackr r r r )r filecompressr r r r r r to_wire_ s z CSYNC.to_wirec C s |dk rt jjdtjd|||d \}}|d7 }|d8 }g } x|dkr|dk rbt jjd|| } ||d } | dks| dkrt jjd|d 7 }|d 8 }|| k rt jjd t|||| j } || 7 }|| 8 }| j| | f qFW | ||||| S ) N zCSYNC too shortz!IHr r& r% zbad CSYNC octets zbad CSYNC bitmap length)r r* Z FormErrorr5 unpackr- Zunwrapr ) r. r r ZwireZcurrentZrdlenr r r r r r1 r r r r from_wiree s, zCSYNC.from_wire)NT)NT)NN)N) __name__ __module__ __qualname____doc__ __slots__r r classmethodr( r9 r> __classcell__r r )r r r s & r ) r5 Z dns.exceptionr Z dns.rdataZ dns.rdatatypeZdns.nameZ dns._compatr ZrdataZRdatar r r r r <module> s PK g\ݹSX X / rdtypes/ANY/__pycache__/MX.cpython-36.opt-1.pycnu [ 3 bWi @ s" d dl ZG dd dejjjZdS ) Nc @ s e Zd ZdZdS )MXz MX recordN)__name__ __module__ __qualname____doc__ r r /usr/lib/python3.6/MX.pyr s r )Zdns.rdtypes.mxbaseZdnsZrdtypesZmxbaseZMXBaser r r r r <module> s PK g\?[' * rdtypes/ANY/__pycache__/URI.cpython-36.pycnu [ 3 bWR @ sD d dl Z d dlZd dlZd dlZd dlmZ G dd dejjZ dS ) N) text_typec sZ e Zd ZdZdddgZ fddZdd d Zedd d Zdd dZ edddZ Z S )URIzURI record @ivar priority: the priority @type priority: int @ivar weight: the weight @type weight: int @ivar target: the target host @type target: dns.name.Name object @see: draft-faltstrom-uri-13priorityweighttargetc sV t t| j|| || _|| _t|dk r6tjjdt |t rL|j | _ n|| _ d S )N zURI target cannot be empty) superr __init__r r lendns exception SyntaxError isinstancer encoder )selfrdclassrdtyper r r ) __class__ /usr/lib/python3.6/URI.pyr ' s z URI.__init__NTc K s d| j | j| jj f S )Nz %d %d "%s")r r r decode)r origin relativizekwr r r to_text2 s z URI.to_textc C sR |j }|j }|j j }|j p*|j s8tjjd|j | |||||j S )NzURI target must be a string) Z get_uint16getZunescapeZis_quoted_stringZ is_identifierr r r Zget_eolvalue) clsr r tokr r r r r r r r from_text6 s z URI.from_textc C s, t jd| j| j}|j| |j| j d S )Nz!HH)structpackr r writer )r filecompressr Ztwo_intsr r r to_wire@ s z URI.to_wirec C sh |dk rt jjdtjd|||d \}}|d7 }|d8 }|||| } ||7 }| ||||| S )N z URI RR is shorter than 5 octetsz!HH )r r Z FormErrorr unpack) r r r ZwireZcurrentZrdlenr r r r r r r from_wireE s z URI.from_wire)NT)NT)NN)N) __name__ __module__ __qualname____doc__ __slots__r r classmethodr r% r) __classcell__r r )r r r s r ) r Z dns.exceptionr Z dns.rdataZdns.nameZ dns._compatr ZrdataZRdatar r r r r <module> s PK g\T/[ [ * rdtypes/ANY/__pycache__/CDS.cpython-36.pycnu [ 3 bWk @ s" d dl ZG dd dejjjZdS ) Nc @ s e Zd ZdZdS )CDSz CDS recordN)__name__ __module__ __qualname____doc__ r r /usr/lib/python3.6/CDS.pyr s r )Zdns.rdtypes.dsbaseZdnsZrdtypesZdsbaseZDSBaser r r r r <module> s PK g\?rj j ) rdtypes/ANY/__pycache__/RT.cpython-36.pycnu [ 3 bW{ @ s" d dl ZG dd dejjjZdS ) Nc @ s e Zd ZdZdS )RTz RT recordN)__name__ __module__ __qualname____doc__ r r /usr/lib/python3.6/RT.pyr s r )Zdns.rdtypes.mxbaseZdnsZrdtypesZmxbaseZUncompressedDowncasingMXr r r r r <module> s PK g\5r r 0 rdtypes/ANY/__pycache__/SPF.cpython-36.opt-1.pycnu [ 3 bW @ s" d dl ZG dd dejjjZdS ) Nc @ s e Zd ZdZdS )SPFz SPF record @see: RFC 4408N)__name__ __module__ __qualname____doc__ r r /usr/lib/python3.6/SPF.pyr s r )Zdns.rdtypes.txtbaseZdnsZrdtypesZtxtbaseZTXTBaser r r r r <module> s PK g\eQ? ? 2 rdtypes/ANY/__pycache__/AFSDB.cpython-36.opt-1.pycnu [ 3 bW8 @ s" d dl ZG dd dejjjZdS ) Nc @ sD e Zd ZdZdd Zdd ZeeeZdd Zdd Z eee Z d S ) AFSDBzAFSDB record @ivar subtype: the subtype value @type subtype: int @ivar hostname: the hostname name @type hostname: dns.name.Name objectc C s | j S )N) preference)self r /usr/lib/python3.6/AFSDB.py get_subtype' s zAFSDB.get_subtypec C s || _ d S )N)r )r subtyper r r set_subtype* s zAFSDB.set_subtypec C s | j S )N)exchange)r r r r get_hostname/ s zAFSDB.get_hostnamec C s || _ d S )N)r )r hostnamer r r set_hostname2 s zAFSDB.set_hostnameN) __name__ __module__ __qualname____doc__r r propertyr r r r r r r r r s r )Zdns.rdtypes.mxbaseZdnsZrdtypesZmxbaseZUncompressedDowncasingMXr r r r r <module> s PK g\ݹSX X ) rdtypes/ANY/__pycache__/MX.cpython-36.pycnu [ 3 bWi @ s" d dl ZG dd dejjjZdS ) Nc @ s e Zd ZdZdS )MXz MX recordN)__name__ __module__ __qualname____doc__ r r /usr/lib/python3.6/MX.pyr s r )Zdns.rdtypes.mxbaseZdnsZrdtypesZmxbaseZMXBaser r r r r <module> s PK g\\m 0 rdtypes/ANY/__pycache__/HIP.cpython-36.opt-1.pycnu [ 3 bW0 @ sH d dl Z d dlZd dlZd dlZd dlZd dlZG dd dejjZ dS ) Nc sf e Zd ZdZddddgZ fddZdd d Zedd d ZdddZ edddZ dddZ Z S )HIPa= HIP record @ivar hit: the host identity tag @type hit: string @ivar algorithm: the public key cryptographic algorithm @type algorithm: int @ivar key: the public key @type key: string @ivar servers: the rendezvous servers @type servers: list of dns.name.Name objects @see: RFC 5205hit algorithmkeyserversc s. t t| j|| || _|| _|| _|| _d S )N)superr __init__r r r r )selfrdclassrdtyper r r r ) __class__ /usr/lib/python3.6/HIP.pyr ) s z HIP.__init__NTc K s t j| jj }tj| jjddj }d}g }x | jD ]}|j |j || q8W t |dkrz|ddj dd |D 7 }d| j |||f S ) N r c s s | ]}|j V qd S )N)Z to_unicode).0xr r r <genexpr>8 s z HIP.to_text.<locals>.<genexpr>z %u %s %s%s)binasciiZhexlifyr decodebase64Z b64encoder replacer appendchoose_relativitylenjoinr ) r origin relativizekwr r textr serverr r r to_text0 s z HIP.to_textc C s |j }tj|j j }t|dkr2tjjdt j |j j }g } x<|j } | j r\P tj j| j|} | j|| | j| qJW | |||||| S )N z HIT too long)Z get_uint8r Z unhexlifyZ get_stringencoder dnsZ exception SyntaxErrorr Z b64decodegetZ is_eol_or_eofname from_textvaluer r ) clsr r tokr r r r r r tokenr" r r r r* ; s z HIP.from_textc C sf t | j}t | j}|jtjd|| j| |j| j |j| j x | jD ]}|j|d | qLW d S )Nz!BBH) r r r writestructpackr r to_wire)r filecompressr lhlkr" r r r r2 L s z HIP.to_wirec C s t jd|||d \}}} |d7 }|d8 }|||| j } ||7 }||8 }|||| j } || 7 }|| 8 }g } xV|dkrtjj|d || |\} }||7 }||8 }|d k r| j|} | j| q|W | ||| || | S )Nz!BBH r )r0 unpackZunwrapr& r) from_wirer r )r, r r ZwireZcurrentZrdlenr r5 r r6 r r r r" Zcusedr r r r9 U s( z HIP.from_wirec C s4 g }x$| j D ]}|j||}|j| q W || _ d S )N)r r r )r r r r r" r r r r l s zHIP.choose_relativity)NT)NT)NN)N)NT) __name__ __module__ __qualname____doc__ __slots__r r# classmethodr* r2 r9 r __classcell__r r )r r r s r ) r0 r r Z dns.exceptionr& Z dns.rdataZ dns.rdatatypeZrdataZRdatar r r r r <module> s PK g\j/jk k 0 rdtypes/ANY/__pycache__/LOC.cpython-36.opt-1.pycnu [ 3 bW/ @ s d dl mZ d dlZd dlZd dlZd dlmZmZm Z e dd e d dD Z dZ dZd Zd d Zd d Zdd Zdd Zdd ZG dd dejjZdS ) )divisionN)longxrangeround_py2_compatc c s | ]}t d | V qdS ) N)r ).0i r /usr/lib/python3.6/LOC.py <genexpr> s r g Y@g .Ag @@c C sh | dkr dS d }x2t ttD ]"}| t| tdkr |d }P q W |d ksT|dk rdtjjd| |S )Nr z%s value out of bounds)r len_powsr dns exception SyntaxError)whatdescZexpr r r r _exponent_of! s r c C s | dk rd}| d9 } nd}t | d } t| d }| |d 8 } t| d }| |d 8 } t| d }| t|d 8 } t| } |||| |fS )Nr r i6 i` i r )r int)r ZsignZdegreesZminutessecondsr r r _float_to_tuple. s r c C sX t | d }|t | d d 7 }|t | d d 7 }|t | d d 7 }t | d | S ) Nr r g N@ g @ g @wKA )float)r valuer r r _tuple_to_float? s r c C s4 t | } t| |d@ }| td| d@ }|d | S )N r )r r pow)r r exponentbaser r r _encode_sizeG s r% c C sV | d@ }|dkr t jjd| | d@ d? }|dkrDt jjd| t|td| S )Nr zbad %s exponent r z bad %s baser )r r r r r" )r r r# r$ r r r _decode_sizeN s r( c s e Zd ZdZddddddgZeeef fdd Zd d d Z e d ddZ d!ddZ e d"ddZ dd Zdd ZeeeddZdd Zd d Zeeed dZ ZS )#LOCa LOC record @ivar latitude: latitude @type latitude: (int, int, int, int, sign) tuple specifying the degrees, minutes, seconds, milliseconds, and sign of the coordinate. @ivar longitude: longitude @type longitude: (int, int, int, int, sign) tuple specifying the degrees, minutes, seconds, milliseconds, and sign of the coordinate. @ivar altitude: altitude @type altitude: float @ivar size: size of the sphere @type size: float @ivar horizontal_precision: horizontal precision @type horizontal_precision: float @ivar vertical_precision: vertical precision @type vertical_precision: float @see: RFC 1876latitude longitudealtitudesizehorizontal_precisionvertical_precisionc s t t| j|| t|ts&t|tr.t|}t|tr@t|}|| _t|tsZt|trbt|}t|trtt|}|| _ t|| _ t|| _ t|| _ t|| _ dS )a Initialize a LOC record instance. The parameters I{latitude} and I{longitude} may be either a 4-tuple of integers specifying (degrees, minutes, seconds, milliseconds), or they may be floating point values specifying the number of degrees. The other parameters are floats. Size, horizontal precision, and vertical precision are specified in centimeters.N)superr) __init__ isinstancer r r r r* r+ r, r- r. r/ ) selfrdclassrdtyper* r+ r, r- hprecvprec) __class__r r r1 o s z LOC.__init__NTc K s | j d dkrd}nd}| jd dkr,d}nd}d| j d | j d | j d | j d || jd | jd | jd | jd || jd f }| jtks| jtks| jtkr|d | jd | jd | jd f 7 }|S ) Nr r NSEWz(%d %d %d.%03d %s %d %d %d.%03d %s %0.2fmr r r g Y@z %0.2fm %0.2fm %0.2fm) r* r+ r, r- _default_sizer. _default_hprecr/ _default_vprec)r3 origin relativizekwZlat_hemisphereZlong_hemispheretextr r r to_text s& z LOC.to_textc C s dddddg}dddddg}t }t} t} |j |d< |j } | j r0t| |d< |j } d| kr| jd\} } | j stj j dt| |d< |d dkrtj j dt | }|dks|dks| j rtj j d |dkrd }n|dkrd }nd}|t| |d< |j } n | j r0t| |d< |j } | d krDd|d < n| dkrZtj j d|j |d< |j } | j rpt| |d< |j } d| krR| jd\} } | j stj j dt| |d< |d dkrtj j dt | }|dks|dks| j rtj j d|dkr$d }n|dkr4d }nd}|t| |d< |j } n | j rpt| |d< |j } | dkrd|d < n| dkrtj j d|j } | d dkr| dd } t | d }|j j }|j s|j}|d dkr|dd }t |d }|j j }|j s|j}|d dkr@|dd }t |d } |j j }|j s|j}|d dkr|dd! }t |d } |j | ||||||| | S )"Nr r .zbad latitude seconds valuer < zlatitude seconds >= 60r z bad latitude milliseconds valued r r: r r9 z bad latitude hemisphere valuezbad longitude seconds valuezlongitude seconds >= 60z bad longitude milliseconds valuer< r; z bad longitude hemisphere valuemg Y@r r r r r r r r r r )r= r> r? Zget_intZ get_stringisdigitr splitr r r r r getZunescapeZ is_eol_or_eofr Zget_eol)clsr4 r5 tokr@ rA r* r+ r- r6 r7 tr millisecondslrH r, tokenr r r r from_text s z LOC.from_textc C s | j d d | j d d | j d d | j d | j d }td | }| jd d | jd d | jd d | jd | jd }td | }t| jtd }t| jd }t| jd } t| jd } tj dd|| | |||} |j | d S )Nr i6 r i` r i r r l i r- zhorizontal precisionzvertical precisionz!BBBBIII) r* r r+ r, r% r- r. r/ structpackwrite) r3 filecompressr@ rO r* r+ r, r- r6 r7 wirer r r to_wire s ( ( z LOC.to_wirec C s t jd|||| \}}} } } } } | tdkrHt| td d } nd ttd| d } | dk sp| dkr|tjjd| tdkrt| td d } ndttd| d } | dk s| dkrtjjdt| d } t|d }t| d } t| d } | ||| | | || | S )Nz!BBBBIIIl i6 r g V@z bad latitudeg f@z bad longitudeg cAr- zhorizontal precisionzvertical precisionr g Vr g f)rS unpackr r r r Z FormErrorr( )rL r4 r5 rX ZcurrentZrdlenr@ versionr- r6 r7 r* r+ r, r r r from_wire s" & z LOC.from_wirec C s t | jS )N)r r* )r3 r r r _get_float_latitude5 s zLOC._get_float_latitudec C s t || _d S )N)r r* )r3 r r r r _set_float_latitude8 s zLOC._set_float_latitudez"latitude as a floating point value)docc C s t | jS )N)r r+ )r3 r r r _get_float_longitude> s zLOC._get_float_longitudec C s t || _d S )N)r r+ )r3 r r r r _set_float_longitudeA s zLOC._set_float_longitudez#longitude as a floating point value)NT)NT)NN)N)__name__ __module__ __qualname____doc__ __slots__r= r> r? r1 rD classmethodrR rY r\ r] r^ propertyZfloat_latituder` ra Zfloat_longitude __classcell__r r )r8 r r) X s& e r) )Z __future__r rS Z dns.exceptionr Z dns.rdataZ dns._compatr r r tupleranger r= r> r? r r r r% r( ZrdataZRdatar) r r r r <module> s PK g\;[ [ 0 rdtypes/ANY/__pycache__/PTR.cpython-36.opt-1.pycnu [ 3 bWk @ s" d dl ZG dd dejjjZdS ) Nc @ s e Zd ZdZdS )PTRz PTR recordN)__name__ __module__ __qualname____doc__ r r /usr/lib/python3.6/PTR.pyr s r )Zdns.rdtypes.nsbaseZdnsZrdtypesZnsbaseZNSBaser r r r r <module> s PK g\> 0 rdtypes/ANY/__pycache__/AVC.cpython-36.opt-1.pycnu [ 3 ӓW @ s" d dl ZG dd dejjjZdS ) Nc @ s e Zd ZdZdS )AVCzbAVC record @see: U{http://www.iana.org/assignments/dns-parameters/AVC/avc-completed-template}N)__name__ __module__ __qualname____doc__ r r /usr/lib/python3.6/AVC.pyr s r )Zdns.rdtypes.txtbaseZdnsZrdtypesZtxtbaseZTXTBaser r r r r <module> s PK g\}< < + rdtypes/ANY/__pycache__/GPOS.cpython-36.pycnu [ 3 bW @ sX d dl Z d dlZd dlZd dlZd dlmZmZ dd Zdd Z G dd dej j Z dS ) N)long text_typec C s | d dks| d dkr$| dd } | j r0d S | jd\}}|dkrV|dkrVtjj|dk rv|j j rvtjj|dk r|j j rtjjd S ) Nr - + . - + )isdigitsplitdns exception FormErrordecode)Zwhatleftright r /usr/lib/python3.6/GPOS.py_validate_float_string s r c C s t | tr| j S | S )N) isinstancer encode)valuer r r _sanitize& s r c s e Zd ZdZdddgZ fddZd!d d Zed"d d Zd#d dZ ed$ddZ dd Z dd Z e e e ddZdd Zdd Ze eeddZd d Zd d Ze eed dZ ZS )%GPOSzGPOS record @ivar latitude: latitude @type latitude: string @ivar longitude: longitude @type longitude: string @ivar altitude: altitude @type altitude: string @see: RFC 1712latitude longitudealtitudec s t t| j|| t|ts0t|ts0t|tr8t|}t|tsVt|tsVt|tr^t|}t|ts|t|ts|t|trt|}t|}t|}t|}t | t | t | || _ || _ || _ d S )N) superr __init__r floatintr strr r r r r )selfrdclassrdtyper r r ) __class__r r r : s, z GPOS.__init__NTc K s d| j j | jj | jj f S )Nz%s %s %s)r r r r )r# origin relativizekwr r r to_textR s z GPOS.to_textc C s0 |j }|j }|j }|j | |||||S )N)Z get_stringZget_eol) clsr$ r% tokr' r( r r r r r r from_textW s zGPOS.from_textc C s t | j}|dk st|jtjd| |j| j t | j}|dk sJt|jtjd| |j| j t | j}|dk s~t|jtjd| |j| j d S )N z!B)lenr AssertionErrorwritestructpackr r )r# filecompressr' lr r r to_wire_ s z GPOS.to_wirec C s || }|d7 }|d8 }||kr(t jj|||| j }||7 }||8 }|| }|d7 }|d8 }||krtt jj|||| j } ||7 }||8 }|| }|d7 }|d8 }||krt jj|||| j } | |||| | S )Nr )r r r Zunwrap) r+ r$ r% ZwireZcurrentZrdlenr' r6 r r r r r r from_wirem s. zGPOS.from_wirec C s t | jS )N)r r )r# r r r _get_float_latitude s zGPOS._get_float_latitudec C s t || _d S )N)r" r )r# r r r r _set_float_latitude s zGPOS._set_float_latitudez"latitude as a floating point value)docc C s t | jS )N)r r )r# r r r _get_float_longitude s zGPOS._get_float_longitudec C s t || _d S )N)r" r )r# r r r r _set_float_longitude s zGPOS._set_float_longitudez#longitude as a floating point valuec C s t | jS )N)r r )r# r r r _get_float_altitude s zGPOS._get_float_altitudec C s t || _d S )N)r" r )r# r r r r _set_float_altitude s zGPOS._set_float_altitudez"altitude as a floating point value)NT)NT)NN)N)__name__ __module__ __qualname____doc__ __slots__r r* classmethodr- r7 r8 r9 r: propertyZfloat_latituder< r= Zfloat_longituder> r? Zfloat_altitude __classcell__r r )r& r r , s* r ) r2 Z dns.exceptionr Z dns.rdataZ dns.tokenizerZ dns._compatr r r r ZrdataZRdatar r r r r <module> s PK g\&c 1 rdtypes/ANY/__pycache__/GPOS.cpython-36.opt-1.pycnu [ 3 bW @ sX d dl Z d dlZd dlZd dlZd dlmZmZ dd Zdd Z G dd dej j Z dS ) N)long text_typec C s | d dks| d dkr$| dd } | j r0d S | jd\}}|dkrV|dkrVtjj|dk rv|j j rvtjj|dk r|j j rtjjd S ) Nr - + . - + )isdigitsplitdns exception FormErrordecode)Zwhatleftright r /usr/lib/python3.6/GPOS.py_validate_float_string s r c C s t | tr| j S | S )N) isinstancer encode)valuer r r _sanitize& s r c s e Zd ZdZdddgZ fddZd!d d Zed"d d Zd#d dZ ed$ddZ dd Z dd Z e e e ddZdd Zdd Ze eeddZd d Zd d Ze eed dZ ZS )%GPOSzGPOS record @ivar latitude: latitude @type latitude: string @ivar longitude: longitude @type longitude: string @ivar altitude: altitude @type altitude: string @see: RFC 1712latitude longitudealtitudec s t t| j|| t|ts0t|ts0t|tr8t|}t|tsVt|tsVt|tr^t|}t|ts|t|ts|t|trt|}t|}t|}t|}t | t | t | || _ || _ || _ d S )N) superr __init__r floatintr strr r r r r )selfrdclassrdtyper r r ) __class__r r r : s, z GPOS.__init__NTc K s d| j j | jj | jj f S )Nz%s %s %s)r r r r )r# origin relativizekwr r r to_textR s z GPOS.to_textc C s0 |j }|j }|j }|j | |||||S )N)Z get_stringZget_eol) clsr$ r% tokr' r( r r r r r r from_textW s zGPOS.from_textc C s| t | j}|jtjd| |j| j t | j}|jtjd| |j| j t | j}|jtjd| |j| j d S )Nz!B)lenr writestructpackr r )r# filecompressr' lr r r to_wire_ s z GPOS.to_wirec C s || }|d7 }|d8 }||kr(t jj|||| j }||7 }||8 }|| }|d7 }|d8 }||krtt jj|||| j } ||7 }||8 }|| }|d7 }|d8 }||krt jj|||| j } | |||| | S )Nr )r r r Zunwrap) r+ r$ r% ZwireZcurrentZrdlenr' r4 r r r r r r from_wirem s. zGPOS.from_wirec C s t | jS )N)r r )r# r r r _get_float_latitude s zGPOS._get_float_latitudec C s t || _d S )N)r" r )r# r r r r _set_float_latitude s zGPOS._set_float_latitudez"latitude as a floating point value)docc C s t | jS )N)r r )r# r r r _get_float_longitude s zGPOS._get_float_longitudec C s t || _d S )N)r" r )r# r r r r _set_float_longitude s zGPOS._set_float_longitudez#longitude as a floating point valuec C s t | jS )N)r r )r# r r r _get_float_altitude s zGPOS._get_float_altitudec C s t || _d S )N)r" r )r# r r r r _set_float_altitude s zGPOS._set_float_altitudez"altitude as a floating point value)NT)NT)NN)N)__name__ __module__ __qualname____doc__ __slots__r r* classmethodr- r5 r6 r7 r8 propertyZfloat_latituder: r; Zfloat_longituder< r= Zfloat_altitude __classcell__r r )r& r r , s* r ) r0 Z dns.exceptionr Z dns.rdataZ dns.tokenizerZ dns._compatr r r r ZrdataZRdatar r r r r <module> s PK g\j+ + rdtypes/ANY/__pycache__/CERT.cpython-36.pycnu [ 3 bWo @ sx d dl Z d dlZd dlZd dlZd dlZd dlZddddddZdd d d d d Zdd Z dd Z G dd dej j Z dS ) NPKIXSPKIPGPURIOID) r r r r r )r r r r r c C s t j| }|d k r|S t| S )N)_ctype_by_namegetint)whatv r /usr/lib/python3.6/CERT.py_ctype_from_text) s r c C s t j| }|d k r|S t| S )N)_ctype_by_valuer str)r r r r r _ctype_to_text0 s r c s\ e Zd ZdZddddgZ fddZdd d Zedd d ZdddZ edddZ Z S )CERTa" CERT record @ivar certificate_type: certificate type @type certificate_type: int @ivar key_tag: key tag @type key_tag: int @ivar algorithm: algorithm @type algorithm: int @ivar certificate: the certificate or CRL @type certificate: string @see: RFC 2538certificate_typekey_tag algorithm certificatec s. t t| j|| || _|| _|| _|| _d S )N)superr __init__r r r r )selfrdclassrdtyper r r r ) __class__r r r G s z CERT.__init__NTc K s0 t | j}d|| jtjj| jtjj| j f S )Nz %s %d %s %s) r r r dnsdnssecZalgorithm_to_textr rdataZ _base64ifyr )r origin relativizekwr r r r to_textO s z CERT.to_textc C s t |j }|j }tjj|j }|dk s4|dkr@tjjdg } x:|j j } | j r\P | j sltjj| j | j j qFW dj| } tj| } | |||||| S )Nr zbad algorithm type )r Z get_stringZ get_uint16r" r# Zalgorithm_from_text exception SyntaxErrorr ZunescapeZ is_eol_or_eofZ is_identifierappendvalueencodejoinbase64Z b64decode) clsr r tokr% r& r r r ZchunkstZb64r r r r from_textU s" zCERT.from_textc C s0 t jd| j| j| j}|j| |j| j d S )Nz!HHB)structpackr r r writer )r filecompressr% prefixr r r to_wirei s z CERT.to_wirec C sl |||d j }|d7 }|d8 }|dk r4tjjtjd|\}} } |||| j } | |||| | | S )N r z!HHB)Zunwrapr" r+ Z FormErrorr6 unpack) r2 r r ZwireZcurrentZrdlenr% r; r r r r r r r from_wireo s zCERT.from_wire)NT)NT)NN)N) __name__ __module__ __qualname____doc__ __slots__r r( classmethodr5 r< r? __classcell__r r )r! r r 7 s r )r6 r1 Z dns.exceptionr" Z dns.dnssecZ dns.rdataZ dns.tokenizerr r r r r$ ZRdatar r r r r <module> s$ PK g\ǃ^ ^ 0 rdtypes/ANY/__pycache__/TXT.cpython-36.opt-1.pycnu [ 3 bWn @ s" d dl ZG dd dejjjZdS ) Nc @ s e Zd ZdZdS )TXTz TXT recordN)__name__ __module__ __qualname____doc__ r r /usr/lib/python3.6/TXT.pyr s r )Zdns.rdtypes.txtbaseZdnsZrdtypesZtxtbaseZTXTBaser r r r r <module> s PK g\ 4 rdtypes/ANY/__pycache__/CDNSKEY.cpython-36.opt-1.pycnu [ 3 bW @ s: d dl Zd dl mZmZ ddgZG dd dejjjZdS ) N)flags_to_text_setflags_from_text_setr r c @ s e Zd ZdZdS )CDNSKEYzCDNSKEY recordN)__name__ __module__ __qualname____doc__ r r /usr/lib/python3.6/CDNSKEY.pyr s r ) Zdns.rdtypes.dnskeybaseZdnsr r __all__ZrdtypesZ dnskeybaseZ DNSKEYBaser r r r r <module> s PK g\) ) 1 rdtypes/ANY/__pycache__/NSEC3PARAM.cpython-36.pycnu [ 3 bW @ sD d dl Z d dlZd dlZd dlZd dlmZ G dd dejjZ dS ) N) text_typec s\ e Zd ZdZddddgZ fddZdd d Zedd d ZdddZ edddZ Z S ) NSEC3PARAMa NSEC3PARAM record @ivar algorithm: the hash algorithm number @type algorithm: int @ivar flags: the flags @type flags: int @ivar iterations: the number of iterations @type iterations: int @ivar salt: the salt @type salt: string algorithmflags iterationssaltc sD t t| j|| || _|| _|| _t|tr:|j | _ n|| _ d S )N) superr __init__r r r isinstancer encoder )selfrdclassrdtyper r r r ) __class__ /usr/lib/python3.6/NSEC3PARAM.pyr ' s zNSEC3PARAM.__init__NTc K s6 | j dkrd}ntj| j j }d| j| j| j|f S )N -z %u %u %u %s)r binasciiZhexlifydecoder r r )r origin relativizekwr r r r to_text1 s zNSEC3PARAM.to_textc C sV |j }|j }|j }|j } | dkr.d} ntj| j } |j | |||||| S )Nr )Z get_uint8Z get_uint16Z get_stringr Z unhexlifyr Zget_eol) clsr r tokr r r r r r r r r from_text9 s zNSEC3PARAM.from_textc C s8 t | j}|jtjd| j| j| j| |j| j d S )Nz!BBHB)lenr writestructpackr r r )r filecompressr lr r r to_wireF s zNSEC3PARAM.to_wirec C sv t jd|||d \}}} } |d7 }|d8 }|||| j } || 7 }|| 8 }|dkrdtjj| ||||| | S )Nz!BBHB r )r unpackZunwrapdnsZ exceptionZ FormError) r r r ZwireZcurrentZrdlenr r r r Zslenr r r r from_wireL s zNSEC3PARAM.from_wire)NT)NT)NN)N) __name__ __module__ __qualname____doc__ __slots__r r classmethodr r% r) __classcell__r r )r r r s r ) r r Z dns.exceptionr( Z dns.rdataZ dns._compatr ZrdataZRdatar r r r r <module> s PK g\UΔ 5 rdtypes/ANY/__pycache__/__init__.cpython-36.opt-1.pycnu [ 3 bW @ sJ d Z ddddddddd d d d d ddddddddddddddd d d d g Zd S )!z'Class ANY (generic) rdata type classes.ZAFSDBZCDNSKEYZCDSZCERTZCNAMEZDLVZDNAMEZDNSKEYZDSZEUI48ZEUI64ZGPOSZHINFOZHIPZISDNZLOCZMXZNSZNSECZNSEC3Z NSEC3PARAMZTLSAZPTRZRPZRRSIGZRTZSOAZSPFZSSHFPZTXTZX25N)__doc____all__ r r /usr/lib/python3.6/__init__.py<module> s> PK g\ ab4[ [ 0 rdtypes/ANY/__pycache__/DLV.cpython-36.opt-1.pycnu [ 3 bW` @ s" d dl ZG dd dejjjZdS ) Nc @ s e Zd ZdZdS )DLVz DLV recordN)__name__ __module__ __qualname____doc__ r r /usr/lib/python3.6/DLV.pyr s r )Zdns.rdtypes.dsbaseZdnsZrdtypesZdsbaseZDSBaser r r r r <module> s PK g\ 2 rdtypes/ANY/__pycache__/EUI64.cpython-36.opt-1.pycnu [ 3 bWn @ s" d dl ZG dd dejjjZdS ) Nc @ s e Zd ZdZdZed d ZdS )EUI64zEUI64 record @ivar fingerprint: 64-bit Extended Unique Identifier (EUI-64) @type fingerprint: string @see: rfc7043.txt N)__name__ __module__ __qualname____doc__Zbyte_lenZtext_len r r /usr/lib/python3.6/EUI64.pyr s r )Zdns.rdtypes.euibaseZdnsZrdtypesZeuibaseZEUIBaser r r r r <module> s PK g\^ 0 rdtypes/ANY/__pycache__/CAA.cpython-36.opt-1.pycnu [ 3 bW> @ s8 d dl Z d dlZd dlZd dlZG dd dejjZdS ) Nc sZ e Zd ZdZdddgZ fddZdd d Zedd d Zdd dZ edddZ Z S )CAAzCAA (Certification Authority Authorization) record @ivar flags: the flags @type flags: int @ivar tag: the tag @type tag: string @ivar value: the value @type value: string @see: RFC 6844flagstagvaluec s( t t| j|| || _|| _|| _d S )N)superr __init__r r r )selfrdclassrdtyper r r ) __class__ /usr/lib/python3.6/CAA.pyr % s z CAA.__init__NTc K s$ d| j tjj| jtjj| jf S )Nz %u %s "%s")r dnsrdataZ _escapifyr r )r origin relativizekwr r r to_text+ s z CAA.to_textc C s\ |j }|j j }t|dkr,tjjd|j s@tjjd|j j }| |||||S )N z tag too longztag is not alphanumeric)Z get_uint8Z get_stringencodelenr Z exception SyntaxErrorisalnum) clsr r tokr r r r r r r r from_text0 s z CAA.from_textc C sL |j tjd| j t| j}|j tjd| |j | j |j | j d S )Nz!B)writestructpackr r r r )r filecompressr lr r r to_wire; s z CAA.to_wirec C s\ t jd|||d \}}|d7 }|||| } ||| || d } | |||| | S )Nz!BB )r unpack) r r r ZwireZcurrentZrdlenr r r! r r r r r from_wireC s z CAA.from_wire)NT)NT)NN)N) __name__ __module__ __qualname____doc__ __slots__r r classmethodr r" r% __classcell__r r )r r r s r )r Z dns.exceptionr Z dns.rdataZ dns.tokenizerr ZRdatar r r r r <module> s PK g\5r r * rdtypes/ANY/__pycache__/SPF.cpython-36.pycnu [ 3 bW @ s" d dl ZG dd dejjjZdS ) Nc @ s e Zd ZdZdS )SPFz SPF record @see: RFC 4408N)__name__ __module__ __qualname____doc__ r r /usr/lib/python3.6/SPF.pyr s r )Zdns.rdtypes.txtbaseZdnsZrdtypesZtxtbaseZTXTBaser r r r r <module> s PK g\h 0 rdtypes/ANY/__pycache__/SOA.cpython-36.opt-1.pycnu [ 3 bW @ s8 d dl Z d dlZd dlZd dlZG dd dejjZdS ) Nc sv e Zd ZdZdddddddgZ fd d Zdd dZedddZdddZ d ddZ ed ddZ d ddZ Z S ) SOAa SOA record @ivar mname: the SOA MNAME (master name) field @type mname: dns.name.Name object @ivar rname: the SOA RNAME (responsible name) field @type rname: dns.name.Name object @ivar serial: The zone's serial number @type serial: int @ivar refresh: The zone's refresh value (in seconds) @type refresh: int @ivar retry: The zone's retry value (in seconds) @type retry: int @ivar expire: The zone's expiration value (in seconds) @type expire: int @ivar minimum: The zone's negative caching time (in seconds, called "minimum" for historical reasons) @type minimum: int @see: RFC 1035mnamernameserialrefreshretryexpireminimumc s@ t t| j|| || _|| _|| _|| _|| _|| _| | _ d S )N) superr __init__r r r r r r r ) selfrdclassrdtyper r r r r r r ) __class__ /usr/lib/python3.6/SOA.pyr / s z SOA.__init__NTc K s< | j j||}| jj||}d||| j| j| j| j| jf S )Nz%s %s %d %d %d %d %d)r choose_relativityr r r r r r )r origin relativizekwr r r r r to_text: s z SOA.to_textc C sp |j }|j }|j||}|j||}|j }|j } |j } |j } |j } |j | |||||| | | | S )N)Zget_namer Z get_uint32Zget_ttlZget_eol) clsr r tokr r r r r r r r r r r r from_textA s z SOA.from_textc C sL | j j||| | jj||| tjd| j| j| j| j| j }|j | d S )Nz!IIIII) r to_wirer structpackr r r r r write)r filecompressr five_intsr r r r P s z SOA.to_wirec C s6 | j j|| jj| tjd| j| j| j| j| j S )Nz!IIIII) r to_digestabler r r r r r r r )r r r r r r! W s zSOA.to_digestablec C s t jj|d || |\}}||7 }||8 }t jj|d || |\} }||7 }||8 }|dkrlt jjtjd|||| } |d k r|j|}| j|} | |||| | d | d | d | d | d S )N z!IIIIIr )dnsname from_wireZ exceptionZ FormErrorr unpackr ) r r r ZwireZcurrentZrdlenr r Zcusedr r r r r r) ] s z SOA.from_wirec C s$ | j j||| _ | jj||| _d S )N)r r r )r r r r r r r p s zSOA.choose_relativity)NT)NT)NN)N)N)NT)__name__ __module__ __qualname____doc__ __slots__r r classmethodr r r! r) r __classcell__r r )r r r s r )r Z dns.exceptionr' Z dns.rdataZdns.nameZrdataZRdatar r r r r <module> s PK g\, + rdtypes/ANY/__pycache__/ISDN.cpython-36.pycnu [ 3 bW @ sD d dl Z d dlZd dlZd dlZd dlmZ G dd dejjZ dS ) N) text_typec sX e Zd ZdZddgZ fddZddd Zedd d Zdd d Z edddZ Z S )ISDNzISDN record @ivar address: the ISDN address @type address: string @ivar subaddress: the ISDN subaddress (or '' if not present) @type subaddress: string @see: RFC 1183address subaddressc sN t t| j|| t|tr(|j | _n|| _t|trD|j | _n|| _d S )N)superr __init__ isinstancer encoder r )selfrdclassrdtyper r ) __class__ /usr/lib/python3.6/ISDN.pyr $ s z ISDN.__init__NTc K s< | j r&dtjj| jtjj| j f S dtjj| j S d S )Nz "%s" "%s"z"%s")r dnsrdataZ _escapifyr )r origin relativizekwr r r to_text/ s z ISDN.to_textc C sP |j }|j }|j s,|j| |j }n|j| d}|j | ||||S )N )Z get_stringgetZ is_eol_or_eofZungetZget_eol) clsr r tokr r r tr r r r from_text6 s zISDN.from_textc C st t | j}|dk st|jtjd| |j| j t | j}|dkrp|dk sRt|jtjd| |j| j d S )N z!Br )lenr AssertionErrorwritestructpackr )r filecompressr lr r r to_wireC s z ISDN.to_wirec C s || }|d7 }|d8 }||kr(t jj|||| j }||7 }||8 }|dkr|| }|d7 }|d8 }||kr|t jj|||| j } nd} | |||| S )N r r )r Z exceptionZ FormErrorZunwrap) r r r ZwireZcurrentZrdlenr r$ r r r r r from_wireN s" zISDN.from_wire)NT)NT)NN)N) __name__ __module__ __qualname____doc__ __slots__r r classmethodr r% r' __classcell__r r )r r r s r ) r Z dns.exceptionr Z dns.rdataZ dns.tokenizerZ dns._compatr r ZRdatar r r r r <module> s PK g\!s , rdtypes/ANY/__pycache__/DNAME.cpython-36.pycnu [ 3 bW @ s" d dl ZG dd dejjjZdS ) Nc @ s e Zd ZdZdddZdS )DNAMEz DNAME recordNc C s | j j|S )N)target to_digestable)selforigin r /usr/lib/python3.6/DNAME.pyr s zDNAME.to_digestable)N)__name__ __module__ __qualname____doc__r r r r r r s r )Zdns.rdtypes.nsbaseZdnsZrdtypesZnsbaseZUncompressedNSr r r r r <module> s PK g\Ip p 2 rdtypes/ANY/__pycache__/CSYNC.cpython-36.opt-1.pycnu [ 3 bW$ @ sL d dl Z d dlZd dlZd dlZd dlZd dlmZ G dd dejj Z dS ) N)xrangec sZ e Zd ZdZdddgZ fddZdd d Zedd d Zdd dZ edddZ Z S )CSYNCzCSYNC record @ivar serial: the SOA serial number @type serial: int @ivar flags: the CSYNC flags @type flags: int @ivar windows: the windowed bitmap list @type windows: list of (window number, string) tuplesserialflagswindowsc s( t t| j|| || _|| _|| _d S )N)superr __init__r r r )selfrdclassrdtyper r r ) __class__ /usr/lib/python3.6/CSYNC.pyr % s zCSYNC.__init__NTc K s d}x| j D ]\}}g }x`tdt|D ]N}|| } x@tddD ]2} | d| ? @ r@|jtjj|d |d | q@W q(W |ddj| 7 }q W d| j| j |f S )N r z%d %d%s) r r lenappenddns rdatatypeto_textjoinr r ) r origin relativizekwtextwindowbitmapbitsibytejr r r r + s z CSYNC.to_textc C s@ |j }|j }g }xZ|j j } | j r,P tjj| j} | dkrNtj j d| dkrbtj j d|j | qW |j d} d} d} t dd }g }x|D ]|} | | krq| } | d }|| kr|j | |d| f t dd }|} | d }|d }|d }|d } || d |? B ||< qW |j | |d| f | |||||S ) Nr zCSYNC with bit 0i zCSYNC with bit > 65535 r r r )Z get_uint32Z get_uint16getZunescapeZ is_eol_or_eofr r from_textvalue exception SyntaxErrorr sort bytearray)clsr r tokr r r r ZrdtypestokenZnrdtyper octetsZ prior_rdtyper r Z new_windowoffsetr" bitr r r r( 8 sF zCSYNC.from_textc C sR |j tjd| j| j x4| jD ]*\}}|j tjd|t| |j | q W d S )Nz!IHz!BB)writestructpackr r r r )r filecompressr r r r r r to_wire_ s z CSYNC.to_wirec C s |dk rt jjdtjd|||d \}}|d7 }|d8 }g } x|dkr|dk rbt jjd|| } ||d } | dks| dkrt jjd|d 7 }|d 8 }|| k rt jjd t|||| j } || 7 }|| 8 }| j| | f qFW | ||||| S ) N zCSYNC too shortz!IHr r& r% zbad CSYNC octets zbad CSYNC bitmap length)r r* Z FormErrorr5 unpackr- Zunwrapr ) r. r r ZwireZcurrentZrdlenr r r r r r1 r r r r from_wiree s, zCSYNC.from_wire)NT)NT)NN)N) __name__ __module__ __qualname____doc__ __slots__r r classmethodr( r9 r> __classcell__r r )r r r s & r ) r5 Z dns.exceptionr Z dns.rdataZ dns.rdatatypeZdns.nameZ dns._compatr ZrdataZRdatar r r r r <module> s PK g\UΔ / rdtypes/ANY/__pycache__/__init__.cpython-36.pycnu [ 3 bW @ sJ d Z ddddddddd d d d d ddddddddddddddd d d d g Zd S )!z'Class ANY (generic) rdata type classes.ZAFSDBZCDNSKEYZCDSZCERTZCNAMEZDLVZDNAMEZDNSKEYZDSZEUI48ZEUI64ZGPOSZHINFOZHIPZISDNZLOCZMXZNSZNSECZNSEC3Z NSEC3PARAMZTLSAZPTRZRPZRRSIGZRTZSOAZSPFZSSHFPZTXTZX25N)__doc____all__ r r /usr/lib/python3.6/__init__.py<module> s> PK g\h * rdtypes/ANY/__pycache__/SOA.cpython-36.pycnu [ 3 bW @ s8 d dl Z d dlZd dlZd dlZG dd dejjZdS ) Nc sv e Zd ZdZdddddddgZ fd d Zdd dZedddZdddZ d ddZ ed ddZ d ddZ Z S ) SOAa SOA record @ivar mname: the SOA MNAME (master name) field @type mname: dns.name.Name object @ivar rname: the SOA RNAME (responsible name) field @type rname: dns.name.Name object @ivar serial: The zone's serial number @type serial: int @ivar refresh: The zone's refresh value (in seconds) @type refresh: int @ivar retry: The zone's retry value (in seconds) @type retry: int @ivar expire: The zone's expiration value (in seconds) @type expire: int @ivar minimum: The zone's negative caching time (in seconds, called "minimum" for historical reasons) @type minimum: int @see: RFC 1035mnamernameserialrefreshretryexpireminimumc s@ t t| j|| || _|| _|| _|| _|| _|| _| | _ d S )N) superr __init__r r r r r r r ) selfrdclassrdtyper r r r r r r ) __class__ /usr/lib/python3.6/SOA.pyr / s z SOA.__init__NTc K s< | j j||}| jj||}d||| j| j| j| j| jf S )Nz%s %s %d %d %d %d %d)r choose_relativityr r r r r r )r origin relativizekwr r r r r to_text: s z SOA.to_textc C sp |j }|j }|j||}|j||}|j }|j } |j } |j } |j } |j | |||||| | | | S )N)Zget_namer Z get_uint32Zget_ttlZget_eol) clsr r tokr r r r r r r r r r r r from_textA s z SOA.from_textc C sL | j j||| | jj||| tjd| j| j| j| j| j }|j | d S )Nz!IIIII) r to_wirer structpackr r r r r write)r filecompressr five_intsr r r r P s z SOA.to_wirec C s6 | j j|| jj| tjd| j| j| j| j| j S )Nz!IIIII) r to_digestabler r r r r r r r )r r r r r r! W s zSOA.to_digestablec C s t jj|d || |\}}||7 }||8 }t jj|d || |\} }||7 }||8 }|dkrlt jjtjd|||| } |d k r|j|}| j|} | |||| | d | d | d | d | d S )N z!IIIIIr )dnsname from_wireZ exceptionZ FormErrorr unpackr ) r r r ZwireZcurrentZrdlenr r Zcusedr r r r r r) ] s z SOA.from_wirec C s$ | j j||| _ | jj||| _d S )N)r r r )r r r r r r r p s zSOA.choose_relativity)NT)NT)NN)N)N)NT)__name__ __module__ __qualname____doc__ __slots__r r classmethodr r r! r) r __classcell__r r )r r r s r )r Z dns.exceptionr' Z dns.rdataZdns.nameZrdataZRdatar r r r r <module> s PK g\) ) 7 rdtypes/ANY/__pycache__/NSEC3PARAM.cpython-36.opt-1.pycnu [ 3 bW @ sD d dl Z d dlZd dlZd dlZd dlmZ G dd dejjZ dS ) N) text_typec s\ e Zd ZdZddddgZ fddZdd d Zedd d ZdddZ edddZ Z S ) NSEC3PARAMa NSEC3PARAM record @ivar algorithm: the hash algorithm number @type algorithm: int @ivar flags: the flags @type flags: int @ivar iterations: the number of iterations @type iterations: int @ivar salt: the salt @type salt: string algorithmflags iterationssaltc sD t t| j|| || _|| _|| _t|tr:|j | _ n|| _ d S )N) superr __init__r r r isinstancer encoder )selfrdclassrdtyper r r r ) __class__ /usr/lib/python3.6/NSEC3PARAM.pyr ' s zNSEC3PARAM.__init__NTc K s6 | j dkrd}ntj| j j }d| j| j| j|f S )N -z %u %u %u %s)r binasciiZhexlifydecoder r r )r origin relativizekwr r r r to_text1 s zNSEC3PARAM.to_textc C sV |j }|j }|j }|j } | dkr.d} ntj| j } |j | |||||| S )Nr )Z get_uint8Z get_uint16Z get_stringr Z unhexlifyr Zget_eol) clsr r tokr r r r r r r r r from_text9 s zNSEC3PARAM.from_textc C s8 t | j}|jtjd| j| j| j| |j| j d S )Nz!BBHB)lenr writestructpackr r r )r filecompressr lr r r to_wireF s zNSEC3PARAM.to_wirec C sv t jd|||d \}}} } |d7 }|d8 }|||| j } || 7 }|| 8 }|dkrdtjj| ||||| | S )Nz!BBHB r )r unpackZunwrapdnsZ exceptionZ FormError) r r r ZwireZcurrentZrdlenr r r r Zslenr r r r from_wireL s zNSEC3PARAM.from_wire)NT)NT)NN)N) __name__ __module__ __qualname____doc__ __slots__r r classmethodr r% r) __classcell__r r )r r r s r ) r r Z dns.exceptionr( Z dns.rdataZ dns._compatr ZrdataZRdatar r r r r <module> s PK g\#c . . , rdtypes/ANY/__pycache__/CNAME.cpython-36.pycnu [ 3 bW< @ s" d dl ZG dd dejjjZdS ) Nc @ s e Zd ZdZdS )CNAMEzCNAME record Note: although CNAME is officially a singleton type, dnspython allows non-singleton CNAME rdatasets because such sets have been commonly used by BIND and other nameservers for load balancing.N)__name__ __module__ __qualname____doc__ r r /usr/lib/python3.6/CNAME.pyr s r )Zdns.rdtypes.nsbaseZdnsZrdtypesZnsbaseZNSBaser r r r r <module> s PK g\ { , rdtypes/ANY/__pycache__/NSEC3.cpython-36.pycnu [ 3 bW @ s d dl Z d dlZd dlZd dlZd dlZd dlZd dlZd dlm Z m Z y ej ddZ ej ddZ W n, ek r ej ddZ ej ddZ Y nX dZdZG dd d ejjZdS ) N)xrange text_typeZ 0123456789ABCDEFGHIJKLMNOPQRSTUVZ ABCDEFGHIJKLMNOPQRSTUVWXYZ234567s 0123456789ABCDEFGHIJKLMNOPQRSTUVs ABCDEFGHIJKLMNOPQRSTUVWXYZ234567 c s` e Zd ZdZddddddgZ fdd Zdd d ZedddZdddZ edddZ Z S )NSEC3a NSEC3 record @ivar algorithm: the hash algorithm number @type algorithm: int @ivar flags: the flags @type flags: int @ivar iterations: the number of iterations @type iterations: int @ivar salt: the salt @type salt: string @ivar next: the next name hash @type next: string @ivar windows: the windowed bitmap list @type windows: list of (window number, string) tuples algorithmflags iterationssaltnextwindowsc sP t t| j|| || _|| _|| _t|tr:|j | _ n|| _ || _ || _ d S )N) superr __init__r r r isinstancer encoder r r ) selfrdclassrdtyper r r r r r ) __class__ /usr/lib/python3.6/NSEC3.pyr ? s zNSEC3.__init__NTc K s t j| jjtj j }| jdkr*d}ntj | jj }d}x| j D ]\}}g } x`t dt |D ]N} || } x@t ddD ]2} | d| ? @ rz| j tjj|d | d | qzW qbW |ddj| 7 }qFW d | j| j| j|||f S ) N - r z%u %u %u %s %s%s)base64Z b32encoder translateb32_normal_to_hexlowerdecoder binasciiZhexlifyr r lenappenddns rdatatypeto_textjoinr r r ) r origin relativizekwr r textwindowbitmapbitsibytejr r r r' L s" z NSEC3.to_textc C s |j }|j }|j }|j } | dkr.d} ntj| jd} |j jdj jt} t j | } g } xZ|j j } | j r|P tjj| j} | dkrtjjd| dkrtjjd| j| qfW | j d}d}d}tdd }g }x| D ]} | |krq| }| d }||krD|dkr4|j|d j|d| f tdd }|}| d }|d }|d }|d }|| d|? B ||< qW |dkr|j||d| f | |||||| | |S )Nr r asciir zNSEC3 with bit 0i zNSEC3 with bit > 65535 r r r r r )Z get_uint8Z get_uint16Z get_stringr" Z unhexlifyr upperr b32_hex_to_normalr Z b32decodegetZunescapeZ is_eol_or_eofr% r& from_textvalue exception SyntaxErrorr$ sort bytearrayr( )clsr r tokr) r* r r r r r ZrdtypestokenZnrdtyper- octetsZ prior_rdtyper. r Z new_windowoffsetr1 bitr r r r9 ` s\ zNSEC3.from_textc C s t | j}|jtjd| j| j| j| |j| j t | j}|jtjd| |j| j x4| j D ]*\}}|jtjd|t | |j| qdW d S )Nz!BBHBz!Bz!BB) r# r writestructpackr r r r r )r filecompressr) lr- r. r r r to_wire s z NSEC3.to_wirec C sZ t jd|||d \}}} } |d7 }|d8 }|||| j } || 7 }|| 8 }|| } |d7 }|d8 }|||| j } || 7 }|| 8 }g }x|dkrB|dk rtjjd|| }||d }|dks|dkrtjjd|d 7 }|d 8 }||k r tjjd t|||| j }||7 }||8 }|j||f qW | ||||| | | |S ) Nz!BBHB r r zNSEC3 too shortr5 zbad NSEC3 octets zbad NSEC3 bitmap length)rF unpackZunwrapr% r; Z FormErrorr> r$ )r? r r ZwireZcurrentZrdlenr) r r r Zslenr Znlenr r r- rB r. r r r from_wire s< zNSEC3.from_wire)NT)NT)NN)N) __name__ __module__ __qualname____doc__ __slots__r r' classmethodr9 rK rP __classcell__r r )r r r , s 1 r )r r" stringrF Z dns.exceptionr% Z dns.rdataZ dns.rdatatypeZ dns._compatr r maketransr7 r AttributeErrorbytesZSHA1ZOPTOUTZrdataZRdatar r r r r <module> s( PK g\eQ? ? , rdtypes/ANY/__pycache__/AFSDB.cpython-36.pycnu [ 3 bW8 @ s" d dl ZG dd dejjjZdS ) Nc @ sD e Zd ZdZdd Zdd ZeeeZdd Zdd Z eee Z d S ) AFSDBzAFSDB record @ivar subtype: the subtype value @type subtype: int @ivar hostname: the hostname name @type hostname: dns.name.Name objectc C s | j S )N) preference)self r /usr/lib/python3.6/AFSDB.py get_subtype' s zAFSDB.get_subtypec C s || _ d S )N)r )r subtyper r r set_subtype* s zAFSDB.set_subtypec C s | j S )N)exchange)r r r r get_hostname/ s zAFSDB.get_hostnamec C s || _ d S )N)r )r hostnamer r r set_hostname2 s zAFSDB.set_hostnameN) __name__ __module__ __qualname____doc__r r propertyr r r r r r r r r s r )Zdns.rdtypes.mxbaseZdnsZrdtypesZmxbaseZUncompressedDowncasingMXr r r r r <module> s PK g\ǃ^ ^ * rdtypes/ANY/__pycache__/TXT.cpython-36.pycnu [ 3 bWn @ s" d dl ZG dd dejjjZdS ) Nc @ s e Zd ZdZdS )TXTz TXT recordN)__name__ __module__ __qualname____doc__ r r /usr/lib/python3.6/TXT.pyr s r )Zdns.rdtypes.txtbaseZdnsZrdtypesZtxtbaseZTXTBaser r r r r <module> s PK g\r , rdtypes/ANY/__pycache__/HINFO.cpython-36.pycnu [ 3 bWi @ sD d dl Z d dlZd dlZd dlZd dlmZ G dd dejjZ dS ) N) text_typec sX e Zd ZdZddgZ fddZddd Zedd d Zdd d Z edddZ Z S )HINFOzHINFO record @ivar cpu: the CPU type @type cpu: string @ivar os: the OS type @type os: string @see: RFC 1035cpuosc sN t t| j|| t|tr(|j | _n|| _t|trD|j | _n|| _d S )N)superr __init__ isinstancer encoder r )selfrdclassrdtyper r ) __class__ /usr/lib/python3.6/HINFO.pyr $ s zHINFO.__init__NTc K s dt jj| jt jj| jf S )Nz "%s" "%s")dnsrdataZ _escapifyr r )r origin relativizekwr r r to_text/ s z HINFO.to_textc C s& |j }|j }|j | ||||S )N)Z get_stringZget_eol)clsr r tokr r r r r r r from_text3 s zHINFO.from_textc C sl t | j}|dk st|jtjd| |j| j t | j}|dk sJt|jtjd| |j| j d S )N z!B)lenr AssertionErrorwritestructpackr )r filecompressr lr r r to_wire: s z HINFO.to_wirec C s || }|d7 }|d8 }||kr(t jj|||| j }||7 }||8 }|| }|d7 }|d8 }||krtt jj|||| j } | |||| S )N )r Z exceptionZ FormErrorZunwrap) r r r ZwireZcurrentZrdlenr r! r r r r r from_wireD s zHINFO.from_wire)NT)NT)NN)N) __name__ __module__ __qualname____doc__ __slots__r r classmethodr r" r$ __classcell__r r )r r r s r ) r Z dns.exceptionr Z dns.rdataZ dns.tokenizerZ dns._compatr r ZRdatar r r r r <module> s PK g\;[ [ * rdtypes/ANY/__pycache__/PTR.cpython-36.pycnu [ 3 bWk @ s" d dl ZG dd dejjjZdS ) Nc @ s e Zd ZdZdS )PTRz PTR recordN)__name__ __module__ __qualname____doc__ r r /usr/lib/python3.6/PTR.pyr s r )Zdns.rdtypes.nsbaseZdnsZrdtypesZnsbaseZNSBaser r r r r <module> s PK g\ig rdtypes/ANY/SOA.pynu [ # Copyright (C) 2003-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. import struct import dns.exception import dns.rdata import dns.name class SOA(dns.rdata.Rdata): """SOA record @ivar mname: the SOA MNAME (master name) field @type mname: dns.name.Name object @ivar rname: the SOA RNAME (responsible name) field @type rname: dns.name.Name object @ivar serial: The zone's serial number @type serial: int @ivar refresh: The zone's refresh value (in seconds) @type refresh: int @ivar retry: The zone's retry value (in seconds) @type retry: int @ivar expire: The zone's expiration value (in seconds) @type expire: int @ivar minimum: The zone's negative caching time (in seconds, called "minimum" for historical reasons) @type minimum: int @see: RFC 1035""" __slots__ = ['mname', 'rname', 'serial', 'refresh', 'retry', 'expire', 'minimum'] def __init__(self, rdclass, rdtype, mname, rname, serial, refresh, retry, expire, minimum): super(SOA, self).__init__(rdclass, rdtype) self.mname = mname self.rname = rname self.serial = serial self.refresh = refresh self.retry = retry self.expire = expire self.minimum = minimum def to_text(self, origin=None, relativize=True, **kw): mname = self.mname.choose_relativity(origin, relativize) rname = self.rname.choose_relativity(origin, relativize) return '%s %s %d %d %d %d %d' % ( mname, rname, self.serial, self.refresh, self.retry, self.expire, self.minimum) @classmethod def from_text(cls, rdclass, rdtype, tok, origin=None, relativize=True): mname = tok.get_name() rname = tok.get_name() mname = mname.choose_relativity(origin, relativize) rname = rname.choose_relativity(origin, relativize) serial = tok.get_uint32() refresh = tok.get_ttl() retry = tok.get_ttl() expire = tok.get_ttl() minimum = tok.get_ttl() tok.get_eol() return cls(rdclass, rdtype, mname, rname, serial, refresh, retry, expire, minimum) def to_wire(self, file, compress=None, origin=None): self.mname.to_wire(file, compress, origin) self.rname.to_wire(file, compress, origin) five_ints = struct.pack('!IIIII', self.serial, self.refresh, self.retry, self.expire, self.minimum) file.write(five_ints) def to_digestable(self, origin=None): return self.mname.to_digestable(origin) + \ self.rname.to_digestable(origin) + \ struct.pack('!IIIII', self.serial, self.refresh, self.retry, self.expire, self.minimum) @classmethod def from_wire(cls, rdclass, rdtype, wire, current, rdlen, origin=None): (mname, cused) = dns.name.from_wire(wire[: current + rdlen], current) current += cused rdlen -= cused (rname, cused) = dns.name.from_wire(wire[: current + rdlen], current) current += cused rdlen -= cused if rdlen != 20: raise dns.exception.FormError five_ints = struct.unpack('!IIIII', wire[current: current + rdlen]) if origin is not None: mname = mname.relativize(origin) rname = rname.relativize(origin) return cls(rdclass, rdtype, mname, rname, five_ints[0], five_ints[1], five_ints[2], five_ints[3], five_ints[4]) def choose_relativity(self, origin=None, relativize=True): self.mname = self.mname.choose_relativity(origin, relativize) self.rname = self.rname.choose_relativity(origin, relativize) PK g\ 2/ / rdtypes/ANY/LOC.pynu [ # Copyright (C) 2003-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. from __future__ import division import struct import dns.exception import dns.rdata from dns._compat import long, xrange, round_py2_compat _pows = tuple(long(10**i) for i in range(0, 11)) # default values are in centimeters _default_size = 100.0 _default_hprec = 1000000.0 _default_vprec = 1000.0 def _exponent_of(what, desc): if what == 0: return 0 exp = None for i in xrange(len(_pows)): if what // _pows[i] == long(0): exp = i - 1 break if exp is None or exp < 0: raise dns.exception.SyntaxError("%s value out of bounds" % desc) return exp def _float_to_tuple(what): if what < 0: sign = -1 what *= -1 else: sign = 1 what = round_py2_compat(what * 3600000) degrees = int(what // 3600000) what -= degrees * 3600000 minutes = int(what // 60000) what -= minutes * 60000 seconds = int(what // 1000) what -= int(seconds * 1000) what = int(what) return (degrees, minutes, seconds, what, sign) def _tuple_to_float(what): value = float(what[0]) value += float(what[1]) / 60.0 value += float(what[2]) / 3600.0 value += float(what[3]) / 3600000.0 return float(what[4]) * value def _encode_size(what, desc): what = long(what) exponent = _exponent_of(what, desc) & 0xF base = what // pow(10, exponent) & 0xF return base * 16 + exponent def _decode_size(what, desc): exponent = what & 0x0F if exponent > 9: raise dns.exception.SyntaxError("bad %s exponent" % desc) base = (what & 0xF0) >> 4 if base > 9: raise dns.exception.SyntaxError("bad %s base" % desc) return long(base) * pow(10, exponent) class LOC(dns.rdata.Rdata): """LOC record @ivar latitude: latitude @type latitude: (int, int, int, int, sign) tuple specifying the degrees, minutes, seconds, milliseconds, and sign of the coordinate. @ivar longitude: longitude @type longitude: (int, int, int, int, sign) tuple specifying the degrees, minutes, seconds, milliseconds, and sign of the coordinate. @ivar altitude: altitude @type altitude: float @ivar size: size of the sphere @type size: float @ivar horizontal_precision: horizontal precision @type horizontal_precision: float @ivar vertical_precision: vertical precision @type vertical_precision: float @see: RFC 1876""" __slots__ = ['latitude', 'longitude', 'altitude', 'size', 'horizontal_precision', 'vertical_precision'] def __init__(self, rdclass, rdtype, latitude, longitude, altitude, size=_default_size, hprec=_default_hprec, vprec=_default_vprec): """Initialize a LOC record instance. The parameters I{latitude} and I{longitude} may be either a 4-tuple of integers specifying (degrees, minutes, seconds, milliseconds), or they may be floating point values specifying the number of degrees. The other parameters are floats. Size, horizontal precision, and vertical precision are specified in centimeters.""" super(LOC, self).__init__(rdclass, rdtype) if isinstance(latitude, int) or isinstance(latitude, long): latitude = float(latitude) if isinstance(latitude, float): latitude = _float_to_tuple(latitude) self.latitude = latitude if isinstance(longitude, int) or isinstance(longitude, long): longitude = float(longitude) if isinstance(longitude, float): longitude = _float_to_tuple(longitude) self.longitude = longitude self.altitude = float(altitude) self.size = float(size) self.horizontal_precision = float(hprec) self.vertical_precision = float(vprec) def to_text(self, origin=None, relativize=True, **kw): if self.latitude[4] > 0: lat_hemisphere = 'N' else: lat_hemisphere = 'S' if self.longitude[4] > 0: long_hemisphere = 'E' else: long_hemisphere = 'W' text = "%d %d %d.%03d %s %d %d %d.%03d %s %0.2fm" % ( self.latitude[0], self.latitude[1], self.latitude[2], self.latitude[3], lat_hemisphere, self.longitude[0], self.longitude[1], self.longitude[2], self.longitude[3], long_hemisphere, self.altitude / 100.0 ) # do not print default values if self.size != _default_size or \ self.horizontal_precision != _default_hprec or \ self.vertical_precision != _default_vprec: text += " %0.2fm %0.2fm %0.2fm" % ( self.size / 100.0, self.horizontal_precision / 100.0, self.vertical_precision / 100.0 ) return text @classmethod def from_text(cls, rdclass, rdtype, tok, origin=None, relativize=True): latitude = [0, 0, 0, 0, 1] longitude = [0, 0, 0, 0, 1] size = _default_size hprec = _default_hprec vprec = _default_vprec latitude[0] = tok.get_int() t = tok.get_string() if t.isdigit(): latitude[1] = int(t) t = tok.get_string() if '.' in t: (seconds, milliseconds) = t.split('.') if not seconds.isdigit(): raise dns.exception.SyntaxError( 'bad latitude seconds value') latitude[2] = int(seconds) if latitude[2] >= 60: raise dns.exception.SyntaxError('latitude seconds >= 60') l = len(milliseconds) if l == 0 or l > 3 or not milliseconds.isdigit(): raise dns.exception.SyntaxError( 'bad latitude milliseconds value') if l == 1: m = 100 elif l == 2: m = 10 else: m = 1 latitude[3] = m * int(milliseconds) t = tok.get_string() elif t.isdigit(): latitude[2] = int(t) t = tok.get_string() if t == 'S': latitude[4] = -1 elif t != 'N': raise dns.exception.SyntaxError('bad latitude hemisphere value') longitude[0] = tok.get_int() t = tok.get_string() if t.isdigit(): longitude[1] = int(t) t = tok.get_string() if '.' in t: (seconds, milliseconds) = t.split('.') if not seconds.isdigit(): raise dns.exception.SyntaxError( 'bad longitude seconds value') longitude[2] = int(seconds) if longitude[2] >= 60: raise dns.exception.SyntaxError('longitude seconds >= 60') l = len(milliseconds) if l == 0 or l > 3 or not milliseconds.isdigit(): raise dns.exception.SyntaxError( 'bad longitude milliseconds value') if l == 1: m = 100 elif l == 2: m = 10 else: m = 1 longitude[3] = m * int(milliseconds) t = tok.get_string() elif t.isdigit(): longitude[2] = int(t) t = tok.get_string() if t == 'W': longitude[4] = -1 elif t != 'E': raise dns.exception.SyntaxError('bad longitude hemisphere value') t = tok.get_string() if t[-1] == 'm': t = t[0: -1] altitude = float(t) * 100.0 # m -> cm token = tok.get().unescape() if not token.is_eol_or_eof(): value = token.value if value[-1] == 'm': value = value[0: -1] size = float(value) * 100.0 # m -> cm token = tok.get().unescape() if not token.is_eol_or_eof(): value = token.value if value[-1] == 'm': value = value[0: -1] hprec = float(value) * 100.0 # m -> cm token = tok.get().unescape() if not token.is_eol_or_eof(): value = token.value if value[-1] == 'm': value = value[0: -1] vprec = float(value) * 100.0 # m -> cm tok.get_eol() return cls(rdclass, rdtype, latitude, longitude, altitude, size, hprec, vprec) def to_wire(self, file, compress=None, origin=None): milliseconds = (self.latitude[0] * 3600000 + self.latitude[1] * 60000 + self.latitude[2] * 1000 + self.latitude[3]) * self.latitude[4] latitude = long(0x80000000) + milliseconds milliseconds = (self.longitude[0] * 3600000 + self.longitude[1] * 60000 + self.longitude[2] * 1000 + self.longitude[3]) * self.longitude[4] longitude = long(0x80000000) + milliseconds altitude = long(self.altitude) + long(10000000) size = _encode_size(self.size, "size") hprec = _encode_size(self.horizontal_precision, "horizontal precision") vprec = _encode_size(self.vertical_precision, "vertical precision") wire = struct.pack("!BBBBIII", 0, size, hprec, vprec, latitude, longitude, altitude) file.write(wire) @classmethod def from_wire(cls, rdclass, rdtype, wire, current, rdlen, origin=None): (version, size, hprec, vprec, latitude, longitude, altitude) = \ struct.unpack("!BBBBIII", wire[current: current + rdlen]) if latitude > long(0x80000000): latitude = float(latitude - long(0x80000000)) / 3600000 else: latitude = -1 * float(long(0x80000000) - latitude) / 3600000 if latitude < -90.0 or latitude > 90.0: raise dns.exception.FormError("bad latitude") if longitude > long(0x80000000): longitude = float(longitude - long(0x80000000)) / 3600000 else: longitude = -1 * float(long(0x80000000) - longitude) / 3600000 if longitude < -180.0 or longitude > 180.0: raise dns.exception.FormError("bad longitude") altitude = float(altitude) - 10000000.0 size = _decode_size(size, "size") hprec = _decode_size(hprec, "horizontal precision") vprec = _decode_size(vprec, "vertical precision") return cls(rdclass, rdtype, latitude, longitude, altitude, size, hprec, vprec) def _get_float_latitude(self): return _tuple_to_float(self.latitude) def _set_float_latitude(self, value): self.latitude = _float_to_tuple(value) float_latitude = property(_get_float_latitude, _set_float_latitude, doc="latitude as a floating point value") def _get_float_longitude(self): return _tuple_to_float(self.longitude) def _set_float_longitude(self, value): self.longitude = _float_to_tuple(value) float_longitude = property(_get_float_longitude, _set_float_longitude, doc="longitude as a floating point value") PK g\ϝs8 8 rdtypes/ANY/AFSDB.pynu [ # Copyright (C) 2003-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. import dns.rdtypes.mxbase class AFSDB(dns.rdtypes.mxbase.UncompressedDowncasingMX): """AFSDB record @ivar subtype: the subtype value @type subtype: int @ivar hostname: the hostname name @type hostname: dns.name.Name object""" # Use the property mechanism to make "subtype" an alias for the # "preference" attribute, and "hostname" an alias for the "exchange" # attribute. # # This lets us inherit the UncompressedMX implementation but lets # the caller use appropriate attribute names for the rdata type. # # We probably lose some performance vs. a cut-and-paste # implementation, but this way we don't copy code, and that's # good. def get_subtype(self): return self.preference def set_subtype(self, subtype): self.preference = subtype subtype = property(get_subtype, set_subtype) def get_hostname(self): return self.exchange def set_hostname(self, hostname): self.exchange = hostname hostname = property(get_hostname, set_hostname) PK g\ZS0 0 rdtypes/ANY/HIP.pynu [ # Copyright (C) 2010, 2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. import struct import base64 import binascii import dns.exception import dns.rdata import dns.rdatatype class HIP(dns.rdata.Rdata): """HIP record @ivar hit: the host identity tag @type hit: string @ivar algorithm: the public key cryptographic algorithm @type algorithm: int @ivar key: the public key @type key: string @ivar servers: the rendezvous servers @type servers: list of dns.name.Name objects @see: RFC 5205""" __slots__ = ['hit', 'algorithm', 'key', 'servers'] def __init__(self, rdclass, rdtype, hit, algorithm, key, servers): super(HIP, self).__init__(rdclass, rdtype) self.hit = hit self.algorithm = algorithm self.key = key self.servers = servers def to_text(self, origin=None, relativize=True, **kw): hit = binascii.hexlify(self.hit).decode() key = base64.b64encode(self.key).replace(b'\n', b'').decode() text = u'' servers = [] for server in self.servers: servers.append(server.choose_relativity(origin, relativize)) if len(servers) > 0: text += (u' ' + u' '.join((x.to_unicode() for x in servers))) return u'%u %s %s%s' % (self.algorithm, hit, key, text) @classmethod def from_text(cls, rdclass, rdtype, tok, origin=None, relativize=True): algorithm = tok.get_uint8() hit = binascii.unhexlify(tok.get_string().encode()) if len(hit) > 255: raise dns.exception.SyntaxError("HIT too long") key = base64.b64decode(tok.get_string().encode()) servers = [] while 1: token = tok.get() if token.is_eol_or_eof(): break server = dns.name.from_text(token.value, origin) server.choose_relativity(origin, relativize) servers.append(server) return cls(rdclass, rdtype, hit, algorithm, key, servers) def to_wire(self, file, compress=None, origin=None): lh = len(self.hit) lk = len(self.key) file.write(struct.pack("!BBH", lh, self.algorithm, lk)) file.write(self.hit) file.write(self.key) for server in self.servers: server.to_wire(file, None, origin) @classmethod def from_wire(cls, rdclass, rdtype, wire, current, rdlen, origin=None): (lh, algorithm, lk) = struct.unpack('!BBH', wire[current: current + 4]) current += 4 rdlen -= 4 hit = wire[current: current + lh].unwrap() current += lh rdlen -= lh key = wire[current: current + lk].unwrap() current += lk rdlen -= lk servers = [] while rdlen > 0: (server, cused) = dns.name.from_wire(wire[: current + rdlen], current) current += cused rdlen -= cused if origin is not None: server = server.relativize(origin) servers.append(server) return cls(rdclass, rdtype, hit, algorithm, key, servers) def choose_relativity(self, origin=None, relativize=True): servers = [] for server in self.servers: server = server.choose_relativity(origin, relativize) servers.append(server) self.servers = servers PK g\° rdtypes/ANY/SSHFP.pynu [ # Copyright (C) 2005-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. import struct import binascii import dns.rdata import dns.rdatatype class SSHFP(dns.rdata.Rdata): """SSHFP record @ivar algorithm: the algorithm @type algorithm: int @ivar fp_type: the digest type @type fp_type: int @ivar fingerprint: the fingerprint @type fingerprint: string @see: draft-ietf-secsh-dns-05.txt""" __slots__ = ['algorithm', 'fp_type', 'fingerprint'] def __init__(self, rdclass, rdtype, algorithm, fp_type, fingerprint): super(SSHFP, self).__init__(rdclass, rdtype) self.algorithm = algorithm self.fp_type = fp_type self.fingerprint = fingerprint def to_text(self, origin=None, relativize=True, **kw): return '%d %d %s' % (self.algorithm, self.fp_type, dns.rdata._hexify(self.fingerprint, chunksize=128)) @classmethod def from_text(cls, rdclass, rdtype, tok, origin=None, relativize=True): algorithm = tok.get_uint8() fp_type = tok.get_uint8() chunks = [] while 1: t = tok.get().unescape() if t.is_eol_or_eof(): break if not t.is_identifier(): raise dns.exception.SyntaxError chunks.append(t.value.encode()) fingerprint = b''.join(chunks) fingerprint = binascii.unhexlify(fingerprint) return cls(rdclass, rdtype, algorithm, fp_type, fingerprint) def to_wire(self, file, compress=None, origin=None): header = struct.pack("!BB", self.algorithm, self.fp_type) file.write(header) file.write(self.fingerprint) @classmethod def from_wire(cls, rdclass, rdtype, wire, current, rdlen, origin=None): header = struct.unpack("!BB", wire[current: current + 2]) current += 2 rdlen -= 2 fingerprint = wire[current: current + rdlen].unwrap() return cls(rdclass, rdtype, header[0], header[1], fingerprint) PK g\n{ { rdtypes/ANY/RT.pynu [ # Copyright (C) 2003-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. import dns.rdtypes.mxbase class RT(dns.rdtypes.mxbase.UncompressedDowncasingMX): """RT record""" PK g\CNcG G rdtypes/ANY/X25.pynu [ # Copyright (C) 2003-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. import struct import dns.exception import dns.rdata import dns.tokenizer from dns._compat import text_type class X25(dns.rdata.Rdata): """X25 record @ivar address: the PSDN address @type address: string @see: RFC 1183""" __slots__ = ['address'] def __init__(self, rdclass, rdtype, address): super(X25, self).__init__(rdclass, rdtype) if isinstance(address, text_type): self.address = address.encode() else: self.address = address def to_text(self, origin=None, relativize=True, **kw): return '"%s"' % dns.rdata._escapify(self.address) @classmethod def from_text(cls, rdclass, rdtype, tok, origin=None, relativize=True): address = tok.get_string() tok.get_eol() return cls(rdclass, rdtype, address) def to_wire(self, file, compress=None, origin=None): l = len(self.address) assert l < 256 file.write(struct.pack('!B', l)) file.write(self.address) @classmethod def from_wire(cls, rdclass, rdtype, wire, current, rdlen, origin=None): l = wire[current] current += 1 rdlen -= 1 if l != rdlen: raise dns.exception.FormError address = wire[current: current + l].unwrap() return cls(rdclass, rdtype, address) PK g\JBi i rdtypes/ANY/DS.pynu [ # Copyright (C) 2003-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. import dns.rdtypes.dsbase class DS(dns.rdtypes.dsbase.DSBase): """DS record""" PK g\[Rei i rdtypes/ANY/NS.pynu [ # Copyright (C) 2003-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. import dns.rdtypes.nsbase class NS(dns.rdtypes.nsbase.NSBase): """NS record""" PK g\0 rdtypes/ANY/__init__.pynu [ # Copyright (C) 2003-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. """Class ANY (generic) rdata type classes.""" __all__ = [ 'AFSDB', 'CDNSKEY', 'CDS', 'CERT', 'CNAME', 'DLV', 'DNAME', 'DNSKEY', 'DS', 'EUI48', 'EUI64', 'GPOS', 'HINFO', 'HIP', 'ISDN', 'LOC', 'MX', 'NS', 'NSEC', 'NSEC3', 'NSEC3PARAM', 'TLSA', 'PTR', 'RP', 'RRSIG', 'RT', 'SOA', 'SPF', 'SSHFP', 'TXT', 'X25', ] PK g\U& rdtypes/ANY/SPF.pynu [ # Copyright (C) 2006, 2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. import dns.rdtypes.txtbase class SPF(dns.rdtypes.txtbase.TXTBase): """SPF record @see: RFC 4408""" PK g\-k k rdtypes/ANY/CDS.pynu [ # Copyright (C) 2003-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. import dns.rdtypes.dsbase class CDS(dns.rdtypes.dsbase.DSBase): """CDS record""" PK g\k9 rdtypes/ANY/NSEC3PARAM.pynu [ # Copyright (C) 2004-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. import struct import binascii import dns.exception import dns.rdata from dns._compat import text_type class NSEC3PARAM(dns.rdata.Rdata): """NSEC3PARAM record @ivar algorithm: the hash algorithm number @type algorithm: int @ivar flags: the flags @type flags: int @ivar iterations: the number of iterations @type iterations: int @ivar salt: the salt @type salt: string""" __slots__ = ['algorithm', 'flags', 'iterations', 'salt'] def __init__(self, rdclass, rdtype, algorithm, flags, iterations, salt): super(NSEC3PARAM, self).__init__(rdclass, rdtype) self.algorithm = algorithm self.flags = flags self.iterations = iterations if isinstance(salt, text_type): self.salt = salt.encode() else: self.salt = salt def to_text(self, origin=None, relativize=True, **kw): if self.salt == b'': salt = '-' else: salt = binascii.hexlify(self.salt).decode() return '%u %u %u %s' % (self.algorithm, self.flags, self.iterations, salt) @classmethod def from_text(cls, rdclass, rdtype, tok, origin=None, relativize=True): algorithm = tok.get_uint8() flags = tok.get_uint8() iterations = tok.get_uint16() salt = tok.get_string() if salt == '-': salt = '' else: salt = binascii.unhexlify(salt.encode()) tok.get_eol() return cls(rdclass, rdtype, algorithm, flags, iterations, salt) def to_wire(self, file, compress=None, origin=None): l = len(self.salt) file.write(struct.pack("!BBHB", self.algorithm, self.flags, self.iterations, l)) file.write(self.salt) @classmethod def from_wire(cls, rdclass, rdtype, wire, current, rdlen, origin=None): (algorithm, flags, iterations, slen) = \ struct.unpack('!BBHB', wire[current: current + 5]) current += 5 rdlen -= 5 salt = wire[current: current + slen].unwrap() current += slen rdlen -= slen if rdlen != 0: raise dns.exception.FormError return cls(rdclass, rdtype, algorithm, flags, iterations, salt) PK g\5_W5 rdtypes/ANY/AVC.pynu [ # Copyright (C) 2016 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. import dns.rdtypes.txtbase class AVC(dns.rdtypes.txtbase.TXTBase): """AVC record @see: U{http://www.iana.org/assignments/dns-parameters/AVC/avc-completed-template}""" PK g\[$$ $ rdtypes/ANY/CSYNC.pynu [ # Copyright (C) 2004-2007, 2009-2011, 2016 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. import struct import dns.exception import dns.rdata import dns.rdatatype import dns.name from dns._compat import xrange class CSYNC(dns.rdata.Rdata): """CSYNC record @ivar serial: the SOA serial number @type serial: int @ivar flags: the CSYNC flags @type flags: int @ivar windows: the windowed bitmap list @type windows: list of (window number, string) tuples""" __slots__ = ['serial', 'flags', 'windows'] def __init__(self, rdclass, rdtype, serial, flags, windows): super(CSYNC, self).__init__(rdclass, rdtype) self.serial = serial self.flags = flags self.windows = windows def to_text(self, origin=None, relativize=True, **kw): text = '' for (window, bitmap) in self.windows: bits = [] for i in xrange(0, len(bitmap)): byte = bitmap[i] for j in xrange(0, 8): if byte & (0x80 >> j): bits.append(dns.rdatatype.to_text(window * 256 + i * 8 + j)) text += (' ' + ' '.join(bits)) return '%d %d%s' % (self.serial, self.flags, text) @classmethod def from_text(cls, rdclass, rdtype, tok, origin=None, relativize=True): serial = tok.get_uint32() flags = tok.get_uint16() rdtypes = [] while 1: token = tok.get().unescape() if token.is_eol_or_eof(): break nrdtype = dns.rdatatype.from_text(token.value) if nrdtype == 0: raise dns.exception.SyntaxError("CSYNC with bit 0") if nrdtype > 65535: raise dns.exception.SyntaxError("CSYNC with bit > 65535") rdtypes.append(nrdtype) rdtypes.sort() window = 0 octets = 0 prior_rdtype = 0 bitmap = bytearray(b'\0' * 32) windows = [] for nrdtype in rdtypes: if nrdtype == prior_rdtype: continue prior_rdtype = nrdtype new_window = nrdtype // 256 if new_window != window: windows.append((window, bitmap[0:octets])) bitmap = bytearray(b'\0' * 32) window = new_window offset = nrdtype % 256 byte = offset // 8 bit = offset % 8 octets = byte + 1 bitmap[byte] = bitmap[byte] | (0x80 >> bit) windows.append((window, bitmap[0:octets])) return cls(rdclass, rdtype, serial, flags, windows) def to_wire(self, file, compress=None, origin=None): file.write(struct.pack('!IH', self.serial, self.flags)) for (window, bitmap) in self.windows: file.write(struct.pack('!BB', window, len(bitmap))) file.write(bitmap) @classmethod def from_wire(cls, rdclass, rdtype, wire, current, rdlen, origin=None): if rdlen < 6: raise dns.exception.FormError("CSYNC too short") (serial, flags) = struct.unpack("!IH", wire[current: current + 6]) current += 6 rdlen -= 6 windows = [] while rdlen > 0: if rdlen < 3: raise dns.exception.FormError("CSYNC too short") window = wire[current] octets = wire[current + 1] if octets == 0 or octets > 32: raise dns.exception.FormError("bad CSYNC octets") current += 2 rdlen -= 2 if rdlen < octets: raise dns.exception.FormError("bad CSYNC bitmap length") bitmap = bytearray(wire[current: current + octets].unwrap()) current += octets rdlen -= octets windows.append((window, bitmap)) return cls(rdclass, rdtype, serial, flags, windows) PK g\EAVk k rdtypes/ANY/PTR.pynu [ # Copyright (C) 2003-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. import dns.rdtypes.nsbase class PTR(dns.rdtypes.nsbase.NSBase): """PTR record""" PK g\Bd rdtypes/ANY/DNAME.pynu [ # Copyright (C) 2003-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. import dns.rdtypes.nsbase class DNAME(dns.rdtypes.nsbase.UncompressedNS): """DNAME record""" def to_digestable(self, origin=None): return self.target.to_digestable(origin) PK g\y1s rdtypes/ANY/GPOS.pynu [ # Copyright (C) 2003-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. import struct import dns.exception import dns.rdata import dns.tokenizer from dns._compat import long, text_type def _validate_float_string(what): if what[0] == b'-'[0] or what[0] == b'+'[0]: what = what[1:] if what.isdigit(): return (left, right) = what.split(b'.') if left == b'' and right == b'': raise dns.exception.FormError if not left == b'' and not left.decode().isdigit(): raise dns.exception.FormError if not right == b'' and not right.decode().isdigit(): raise dns.exception.FormError def _sanitize(value): if isinstance(value, text_type): return value.encode() return value class GPOS(dns.rdata.Rdata): """GPOS record @ivar latitude: latitude @type latitude: string @ivar longitude: longitude @type longitude: string @ivar altitude: altitude @type altitude: string @see: RFC 1712""" __slots__ = ['latitude', 'longitude', 'altitude'] def __init__(self, rdclass, rdtype, latitude, longitude, altitude): super(GPOS, self).__init__(rdclass, rdtype) if isinstance(latitude, float) or \ isinstance(latitude, int) or \ isinstance(latitude, long): latitude = str(latitude) if isinstance(longitude, float) or \ isinstance(longitude, int) or \ isinstance(longitude, long): longitude = str(longitude) if isinstance(altitude, float) or \ isinstance(altitude, int) or \ isinstance(altitude, long): altitude = str(altitude) latitude = _sanitize(latitude) longitude = _sanitize(longitude) altitude = _sanitize(altitude) _validate_float_string(latitude) _validate_float_string(longitude) _validate_float_string(altitude) self.latitude = latitude self.longitude = longitude self.altitude = altitude def to_text(self, origin=None, relativize=True, **kw): return '%s %s %s' % (self.latitude.decode(), self.longitude.decode(), self.altitude.decode()) @classmethod def from_text(cls, rdclass, rdtype, tok, origin=None, relativize=True): latitude = tok.get_string() longitude = tok.get_string() altitude = tok.get_string() tok.get_eol() return cls(rdclass, rdtype, latitude, longitude, altitude) def to_wire(self, file, compress=None, origin=None): l = len(self.latitude) assert l < 256 file.write(struct.pack('!B', l)) file.write(self.latitude) l = len(self.longitude) assert l < 256 file.write(struct.pack('!B', l)) file.write(self.longitude) l = len(self.altitude) assert l < 256 file.write(struct.pack('!B', l)) file.write(self.altitude) @classmethod def from_wire(cls, rdclass, rdtype, wire, current, rdlen, origin=None): l = wire[current] current += 1 rdlen -= 1 if l > rdlen: raise dns.exception.FormError latitude = wire[current: current + l].unwrap() current += l rdlen -= l l = wire[current] current += 1 rdlen -= 1 if l > rdlen: raise dns.exception.FormError longitude = wire[current: current + l].unwrap() current += l rdlen -= l l = wire[current] current += 1 rdlen -= 1 if l != rdlen: raise dns.exception.FormError altitude = wire[current: current + l].unwrap() return cls(rdclass, rdtype, latitude, longitude, altitude) def _get_float_latitude(self): return float(self.latitude) def _set_float_latitude(self, value): self.latitude = str(value) float_latitude = property(_get_float_latitude, _set_float_latitude, doc="latitude as a floating point value") def _get_float_longitude(self): return float(self.longitude) def _set_float_longitude(self, value): self.longitude = str(value) float_longitude = property(_get_float_longitude, _set_float_longitude, doc="longitude as a floating point value") def _get_float_altitude(self): return float(self.altitude) def _set_float_altitude(self, value): self.altitude = str(value) float_altitude = property(_get_float_altitude, _set_float_altitude, doc="altitude as a floating point value") PK g\,i i rdtypes/ANY/MX.pynu [ # Copyright (C) 2003-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. import dns.rdtypes.mxbase class MX(dns.rdtypes.mxbase.MXBase): """MX record""" PK g\&͡ rdtypes/ANY/NSEC3.pynu [ # Copyright (C) 2004-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. import base64 import binascii import string import struct import dns.exception import dns.rdata import dns.rdatatype from dns._compat import xrange, text_type try: b32_hex_to_normal = string.maketrans('0123456789ABCDEFGHIJKLMNOPQRSTUV', 'ABCDEFGHIJKLMNOPQRSTUVWXYZ234567') b32_normal_to_hex = string.maketrans('ABCDEFGHIJKLMNOPQRSTUVWXYZ234567', '0123456789ABCDEFGHIJKLMNOPQRSTUV') except AttributeError: b32_hex_to_normal = bytes.maketrans(b'0123456789ABCDEFGHIJKLMNOPQRSTUV', b'ABCDEFGHIJKLMNOPQRSTUVWXYZ234567') b32_normal_to_hex = bytes.maketrans(b'ABCDEFGHIJKLMNOPQRSTUVWXYZ234567', b'0123456789ABCDEFGHIJKLMNOPQRSTUV') # hash algorithm constants SHA1 = 1 # flag constants OPTOUT = 1 class NSEC3(dns.rdata.Rdata): """NSEC3 record @ivar algorithm: the hash algorithm number @type algorithm: int @ivar flags: the flags @type flags: int @ivar iterations: the number of iterations @type iterations: int @ivar salt: the salt @type salt: string @ivar next: the next name hash @type next: string @ivar windows: the windowed bitmap list @type windows: list of (window number, string) tuples""" __slots__ = ['algorithm', 'flags', 'iterations', 'salt', 'next', 'windows'] def __init__(self, rdclass, rdtype, algorithm, flags, iterations, salt, next, windows): super(NSEC3, self).__init__(rdclass, rdtype) self.algorithm = algorithm self.flags = flags self.iterations = iterations if isinstance(salt, text_type): self.salt = salt.encode() else: self.salt = salt self.next = next self.windows = windows def to_text(self, origin=None, relativize=True, **kw): next = base64.b32encode(self.next).translate( b32_normal_to_hex).lower().decode() if self.salt == b'': salt = '-' else: salt = binascii.hexlify(self.salt).decode() text = u'' for (window, bitmap) in self.windows: bits = [] for i in xrange(0, len(bitmap)): byte = bitmap[i] for j in xrange(0, 8): if byte & (0x80 >> j): bits.append(dns.rdatatype.to_text(window * 256 + i * 8 + j)) text += (u' ' + u' '.join(bits)) return u'%u %u %u %s %s%s' % (self.algorithm, self.flags, self.iterations, salt, next, text) @classmethod def from_text(cls, rdclass, rdtype, tok, origin=None, relativize=True): algorithm = tok.get_uint8() flags = tok.get_uint8() iterations = tok.get_uint16() salt = tok.get_string() if salt == u'-': salt = b'' else: salt = binascii.unhexlify(salt.encode('ascii')) next = tok.get_string().encode( 'ascii').upper().translate(b32_hex_to_normal) next = base64.b32decode(next) rdtypes = [] while 1: token = tok.get().unescape() if token.is_eol_or_eof(): break nrdtype = dns.rdatatype.from_text(token.value) if nrdtype == 0: raise dns.exception.SyntaxError("NSEC3 with bit 0") if nrdtype > 65535: raise dns.exception.SyntaxError("NSEC3 with bit > 65535") rdtypes.append(nrdtype) rdtypes.sort() window = 0 octets = 0 prior_rdtype = 0 bitmap = bytearray(b'\0' * 32) windows = [] for nrdtype in rdtypes: if nrdtype == prior_rdtype: continue prior_rdtype = nrdtype new_window = nrdtype // 256 if new_window != window: if octets != 0: windows.append((window, ''.join(bitmap[0:octets]))) bitmap = bytearray(b'\0' * 32) window = new_window offset = nrdtype % 256 byte = offset // 8 bit = offset % 8 octets = byte + 1 bitmap[byte] = bitmap[byte] | (0x80 >> bit) if octets != 0: windows.append((window, bitmap[0:octets])) return cls(rdclass, rdtype, algorithm, flags, iterations, salt, next, windows) def to_wire(self, file, compress=None, origin=None): l = len(self.salt) file.write(struct.pack("!BBHB", self.algorithm, self.flags, self.iterations, l)) file.write(self.salt) l = len(self.next) file.write(struct.pack("!B", l)) file.write(self.next) for (window, bitmap) in self.windows: file.write(struct.pack("!BB", window, len(bitmap))) file.write(bitmap) @classmethod def from_wire(cls, rdclass, rdtype, wire, current, rdlen, origin=None): (algorithm, flags, iterations, slen) = \ struct.unpack('!BBHB', wire[current: current + 5]) current += 5 rdlen -= 5 salt = wire[current: current + slen].unwrap() current += slen rdlen -= slen nlen = wire[current] current += 1 rdlen -= 1 next = wire[current: current + nlen].unwrap() current += nlen rdlen -= nlen windows = [] while rdlen > 0: if rdlen < 3: raise dns.exception.FormError("NSEC3 too short") window = wire[current] octets = wire[current + 1] if octets == 0 or octets > 32: raise dns.exception.FormError("bad NSEC3 octets") current += 2 rdlen -= 2 if rdlen < octets: raise dns.exception.FormError("bad NSEC3 bitmap length") bitmap = bytearray(wire[current: current + octets].unwrap()) current += octets rdlen -= octets windows.append((window, bitmap)) return cls(rdclass, rdtype, algorithm, flags, iterations, salt, next, windows) PK g\` ` rdtypes/ANY/DLV.pynu [ # Copyright (C) 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. import dns.rdtypes.dsbase class DLV(dns.rdtypes.dsbase.DSBase): """DLV record""" PK g\Cn n rdtypes/ANY/TXT.pynu [ # Copyright (C) 2003-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. import dns.rdtypes.txtbase class TXT(dns.rdtypes.txtbase.TXTBase): """TXT record""" PK g\x > > rdtypes/ANY/CAA.pynu [ # Copyright (C) 2003-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. import struct import dns.exception import dns.rdata import dns.tokenizer class CAA(dns.rdata.Rdata): """CAA (Certification Authority Authorization) record @ivar flags: the flags @type flags: int @ivar tag: the tag @type tag: string @ivar value: the value @type value: string @see: RFC 6844""" __slots__ = ['flags', 'tag', 'value'] def __init__(self, rdclass, rdtype, flags, tag, value): super(CAA, self).__init__(rdclass, rdtype) self.flags = flags self.tag = tag self.value = value def to_text(self, origin=None, relativize=True, **kw): return '%u %s "%s"' % (self.flags, dns.rdata._escapify(self.tag), dns.rdata._escapify(self.value)) @classmethod def from_text(cls, rdclass, rdtype, tok, origin=None, relativize=True): flags = tok.get_uint8() tag = tok.get_string().encode() if len(tag) > 255: raise dns.exception.SyntaxError("tag too long") if not tag.isalnum(): raise dns.exception.SyntaxError("tag is not alphanumeric") value = tok.get_string().encode() return cls(rdclass, rdtype, flags, tag, value) def to_wire(self, file, compress=None, origin=None): file.write(struct.pack('!B', self.flags)) l = len(self.tag) assert l < 256 file.write(struct.pack('!B', l)) file.write(self.tag) file.write(self.value) @classmethod def from_wire(cls, rdclass, rdtype, wire, current, rdlen, origin=None): (flags, l) = struct.unpack('!BB', wire[current: current + 2]) current += 2 tag = wire[current: current + l] value = wire[current + l:current + rdlen - 2] return cls(rdclass, rdtype, flags, tag, value) PK g\o:Ri i rdtypes/ANY/HINFO.pynu [ # Copyright (C) 2003-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. import struct import dns.exception import dns.rdata import dns.tokenizer from dns._compat import text_type class HINFO(dns.rdata.Rdata): """HINFO record @ivar cpu: the CPU type @type cpu: string @ivar os: the OS type @type os: string @see: RFC 1035""" __slots__ = ['cpu', 'os'] def __init__(self, rdclass, rdtype, cpu, os): super(HINFO, self).__init__(rdclass, rdtype) if isinstance(cpu, text_type): self.cpu = cpu.encode() else: self.cpu = cpu if isinstance(os, text_type): self.os = os.encode() else: self.os = os def to_text(self, origin=None, relativize=True, **kw): return '"%s" "%s"' % (dns.rdata._escapify(self.cpu), dns.rdata._escapify(self.os)) @classmethod def from_text(cls, rdclass, rdtype, tok, origin=None, relativize=True): cpu = tok.get_string() os = tok.get_string() tok.get_eol() return cls(rdclass, rdtype, cpu, os) def to_wire(self, file, compress=None, origin=None): l = len(self.cpu) assert l < 256 file.write(struct.pack('!B', l)) file.write(self.cpu) l = len(self.os) assert l < 256 file.write(struct.pack('!B', l)) file.write(self.os) @classmethod def from_wire(cls, rdclass, rdtype, wire, current, rdlen, origin=None): l = wire[current] current += 1 rdlen -= 1 if l > rdlen: raise dns.exception.FormError cpu = wire[current:current + l].unwrap() current += l rdlen -= l l = wire[current] current += 1 rdlen -= 1 if l != rdlen: raise dns.exception.FormError os = wire[current: current + l].unwrap() return cls(rdclass, rdtype, cpu, os) PK g\Qx rdtypes/ANY/ISDN.pynu [ # Copyright (C) 2003-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. import struct import dns.exception import dns.rdata import dns.tokenizer from dns._compat import text_type class ISDN(dns.rdata.Rdata): """ISDN record @ivar address: the ISDN address @type address: string @ivar subaddress: the ISDN subaddress (or '' if not present) @type subaddress: string @see: RFC 1183""" __slots__ = ['address', 'subaddress'] def __init__(self, rdclass, rdtype, address, subaddress): super(ISDN, self).__init__(rdclass, rdtype) if isinstance(address, text_type): self.address = address.encode() else: self.address = address if isinstance(address, text_type): self.subaddress = subaddress.encode() else: self.subaddress = subaddress def to_text(self, origin=None, relativize=True, **kw): if self.subaddress: return '"%s" "%s"' % (dns.rdata._escapify(self.address), dns.rdata._escapify(self.subaddress)) else: return '"%s"' % dns.rdata._escapify(self.address) @classmethod def from_text(cls, rdclass, rdtype, tok, origin=None, relativize=True): address = tok.get_string() t = tok.get() if not t.is_eol_or_eof(): tok.unget(t) subaddress = tok.get_string() else: tok.unget(t) subaddress = '' tok.get_eol() return cls(rdclass, rdtype, address, subaddress) def to_wire(self, file, compress=None, origin=None): l = len(self.address) assert l < 256 file.write(struct.pack('!B', l)) file.write(self.address) l = len(self.subaddress) if l > 0: assert l < 256 file.write(struct.pack('!B', l)) file.write(self.subaddress) @classmethod def from_wire(cls, rdclass, rdtype, wire, current, rdlen, origin=None): l = wire[current] current += 1 rdlen -= 1 if l > rdlen: raise dns.exception.FormError address = wire[current: current + l].unwrap() current += l rdlen -= l if rdlen > 0: l = wire[current] current += 1 rdlen -= 1 if l != rdlen: raise dns.exception.FormError subaddress = wire[current: current + l].unwrap() else: subaddress = '' return cls(rdclass, rdtype, address, subaddress) PK g\o( < < rdtypes/ANY/CNAME.pynu [ # Copyright (C) 2003-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. import dns.rdtypes.nsbase class CNAME(dns.rdtypes.nsbase.NSBase): """CNAME record Note: although CNAME is officially a singleton type, dnspython allows non-singleton CNAME rdatasets because such sets have been commonly used by BIND and other nameservers for load balancing.""" PK g\X rdtypes/ANY/RRSIG.pynu [ # Copyright (C) 2004-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. import base64 import calendar import struct import time import dns.dnssec import dns.exception import dns.rdata import dns.rdatatype class BadSigTime(dns.exception.DNSException): """Time in DNS SIG or RRSIG resource record cannot be parsed.""" def sigtime_to_posixtime(what): if len(what) != 14: raise BadSigTime year = int(what[0:4]) month = int(what[4:6]) day = int(what[6:8]) hour = int(what[8:10]) minute = int(what[10:12]) second = int(what[12:14]) return calendar.timegm((year, month, day, hour, minute, second, 0, 0, 0)) def posixtime_to_sigtime(what): return time.strftime('%Y%m%d%H%M%S', time.gmtime(what)) class RRSIG(dns.rdata.Rdata): """RRSIG record @ivar type_covered: the rdata type this signature covers @type type_covered: int @ivar algorithm: the algorithm used for the sig @type algorithm: int @ivar labels: number of labels @type labels: int @ivar original_ttl: the original TTL @type original_ttl: long @ivar expiration: signature expiration time @type expiration: long @ivar inception: signature inception time @type inception: long @ivar key_tag: the key tag @type key_tag: int @ivar signer: the signer @type signer: dns.name.Name object @ivar signature: the signature @type signature: string""" __slots__ = ['type_covered', 'algorithm', 'labels', 'original_ttl', 'expiration', 'inception', 'key_tag', 'signer', 'signature'] def __init__(self, rdclass, rdtype, type_covered, algorithm, labels, original_ttl, expiration, inception, key_tag, signer, signature): super(RRSIG, self).__init__(rdclass, rdtype) self.type_covered = type_covered self.algorithm = algorithm self.labels = labels self.original_ttl = original_ttl self.expiration = expiration self.inception = inception self.key_tag = key_tag self.signer = signer self.signature = signature def covers(self): return self.type_covered def to_text(self, origin=None, relativize=True, **kw): return '%s %d %d %d %s %s %d %s %s' % ( dns.rdatatype.to_text(self.type_covered), self.algorithm, self.labels, self.original_ttl, posixtime_to_sigtime(self.expiration), posixtime_to_sigtime(self.inception), self.key_tag, self.signer.choose_relativity(origin, relativize), dns.rdata._base64ify(self.signature) ) @classmethod def from_text(cls, rdclass, rdtype, tok, origin=None, relativize=True): type_covered = dns.rdatatype.from_text(tok.get_string()) algorithm = dns.dnssec.algorithm_from_text(tok.get_string()) labels = tok.get_int() original_ttl = tok.get_ttl() expiration = sigtime_to_posixtime(tok.get_string()) inception = sigtime_to_posixtime(tok.get_string()) key_tag = tok.get_int() signer = tok.get_name() signer = signer.choose_relativity(origin, relativize) chunks = [] while 1: t = tok.get().unescape() if t.is_eol_or_eof(): break if not t.is_identifier(): raise dns.exception.SyntaxError chunks.append(t.value.encode()) b64 = b''.join(chunks) signature = base64.b64decode(b64) return cls(rdclass, rdtype, type_covered, algorithm, labels, original_ttl, expiration, inception, key_tag, signer, signature) def to_wire(self, file, compress=None, origin=None): header = struct.pack('!HBBIIIH', self.type_covered, self.algorithm, self.labels, self.original_ttl, self.expiration, self.inception, self.key_tag) file.write(header) self.signer.to_wire(file, None, origin) file.write(self.signature) @classmethod def from_wire(cls, rdclass, rdtype, wire, current, rdlen, origin=None): header = struct.unpack('!HBBIIIH', wire[current: current + 18]) current += 18 rdlen -= 18 (signer, cused) = dns.name.from_wire(wire[: current + rdlen], current) current += cused rdlen -= cused if origin is not None: signer = signer.relativize(origin) signature = wire[current: current + rdlen].unwrap() return cls(rdclass, rdtype, header[0], header[1], header[2], header[3], header[4], header[5], header[6], signer, signature) def choose_relativity(self, origin=None, relativize=True): self.signer = self.signer.choose_relativity(origin, relativize) PK g\ rdtypes/euibase.pynu [ # Copyright (C) 2015 Red Hat, Inc. # Author: Petr Spacek <pspacek@redhat.com> # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED 'AS IS' AND RED HAT DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. import binascii import dns.rdata from dns._compat import xrange class EUIBase(dns.rdata.Rdata): """EUIxx record @ivar fingerprint: xx-bit Extended Unique Identifier (EUI-xx) @type fingerprint: string @see: rfc7043.txt""" __slots__ = ['eui'] # define these in subclasses # byte_len = 6 # 0123456789ab (in hex) # text_len = byte_len * 3 - 1 # 01-23-45-67-89-ab def __init__(self, rdclass, rdtype, eui): super(EUIBase, self).__init__(rdclass, rdtype) if len(eui) != self.byte_len: raise dns.exception.FormError('EUI%s rdata has to have %s bytes' % (self.byte_len * 8, self.byte_len)) self.eui = eui def to_text(self, origin=None, relativize=True, **kw): return dns.rdata._hexify(self.eui, chunksize=2).replace(' ', '-') @classmethod def from_text(cls, rdclass, rdtype, tok, origin=None, relativize=True): text = tok.get_string() tok.get_eol() if len(text) != cls.text_len: raise dns.exception.SyntaxError( 'Input text must have %s characters' % cls.text_len) expected_dash_idxs = xrange(2, cls.byte_len * 3 - 1, 3) for i in expected_dash_idxs: if text[i] != '-': raise dns.exception.SyntaxError('Dash expected at position %s' % i) text = text.replace('-', '') try: data = binascii.unhexlify(text.encode()) except (ValueError, TypeError) as ex: raise dns.exception.SyntaxError('Hex decoding error: %s' % str(ex)) return cls(rdclass, rdtype, data) def to_wire(self, file, compress=None, origin=None): file.write(self.eui) @classmethod def from_wire(cls, rdclass, rdtype, wire, current, rdlen, origin=None): eui = wire[current:current + rdlen].unwrap() return cls(rdclass, rdtype, eui) PK g\v~u u ) rdtypes/__pycache__/nsbase.cpython-36.pycnu [ 3 bW# @ sP d Z ddlmZ ddlZddlZddlZG dd dejjZ G dd de Z dS )zNS-like base classes. )BytesIONc sj e Zd ZdZdgZ fddZdddZedd d Zdd d Z dd dZ edddZ dddZ Z S )NSBasezBase class for rdata that is like an NS record. @ivar target: the target name of the rdata @type target: dns.name.Name objecttargetc s t t| j|| || _d S )N)superr __init__r )selfrdclassrdtyper ) __class__ /usr/lib/python3.6/nsbase.pyr " s zNSBase.__init__NTc K s | j j||}t|S )N)r choose_relativitystr)r origin relativizekwr r r r to_text& s zNSBase.to_textc C s( |j }|j||}|j | |||S )N)Zget_namer Zget_eol)clsr r tokr r r r r r from_text* s zNSBase.from_textc C s | j j||| d S )N)r to_wire)r filecompressr r r r r 1 s zNSBase.to_wirec C s | j j|S )N)r to_digestable)r r r r r r 4 s zNSBase.to_digestablec C sL t jj|d || |\}}||kr.t jj|d k r@|j|}| |||S )N)dnsname from_wireZ exceptionZ FormErrorr ) r r r ZwireZcurrentZrdlenr r Zcusedr r r r 7 s zNSBase.from_wirec C s | j j||| _ d S )N)r r )r r r r r r r A s zNSBase.choose_relativity)NT)NT)NN)N)N)NT)__name__ __module__ __qualname____doc__ __slots__r r classmethodr r r r r __classcell__r r )r r r s r c s, e Zd ZdZd fdd ZdddZ ZS ) UncompressedNSzBase class for rdata that is like an NS record, but whose name is not compressed when convert to DNS wire format, and whose digestable form is not downcased.Nc s t t| j|d | d S )N)r r$ r )r r r r )r r r r K s zUncompressedNS.to_wirec C s t }| j|d | |j S )N)r r getvalue)r r fr r r r N s z UncompressedNS.to_digestable)NN)N)r r r r r r r# r r )r r r$ E s r$ ) r ior Z dns.exceptionr Z dns.rdataZdns.nameZrdataZRdatar r$ r r r r <module> s ,PK g\ac c * rdtypes/__pycache__/euibase.cpython-36.pycnu [ 3 bW @ s4 d dl Z d dlZd dlmZ G dd dejjZdS ) N)xrangec sV e Zd ZdZdgZ fddZdddZedd d Zdd d Z edd dZ Z S )EUIBasezEUIxx record @ivar fingerprint: xx-bit Extended Unique Identifier (EUI-xx) @type fingerprint: string @see: rfc7043.txteuic sF t t| j|| t|| jkr<tjjd| jd | jf || _d S )Nz EUI%s rdata has to have %s bytes ) superr __init__lenbyte_lendns exceptionZ FormErrorr )selfrdclassrdtyper ) __class__ /usr/lib/python3.6/euibase.pyr $ s zEUIBase.__init__NTc K s t jj| jddjddS )N )Z chunksize -)r rdataZ_hexifyr replace)r origin relativizekwr r r to_text+ s zEUIBase.to_textc C s |j }|j t|| jkr0tjjd| j td| jd d d}x(|D ] }|| dkrLtjjd| qLW |j dd}yt j |j } W n: t tfk r } ztjjdt| W Y d d } ~ X nX | ||| S ) Nz"Input text must have %s charactersr r z Dash expected at position %s zHex decoding error: %s)Z get_stringZget_eolr Ztext_lenr r SyntaxErrorr r r binasciiZ unhexlifyencode ValueError TypeErrorstr) clsr r tokr r textZexpected_dash_idxsidataZexr r r from_text. s &zEUIBase.from_textc C s |j | j d S )N)writer )r filecompressr r r r to_wireA s zEUIBase.to_wirec C s |||| j }| |||S )N)Zunwrap)r$ r r ZwireZcurrentZrdlenr r r r r from_wireD s zEUIBase.from_wire)NT)NT)NN)N) __name__ __module__ __qualname____doc__ __slots__r r classmethodr) r- r. __classcell__r r )r r r s r )r Z dns.rdatar Z dns._compatr r ZRdatar r r r r <module> s PK g\V5 5 - rdtypes/__pycache__/dnskeybase.cpython-36.pycnu [ 3 bW# @ s d dl Z d dlZd dlZd dlZd dlZdddddgZdZdZd Z eee d Z e d d e j D Z d d Zdd ZG dd dejjZdS ) NSEPREVOKEZONEflags_to_text_setflags_from_text_set )r r r c c s | ]\}}||fV qd S )N ).0xyr r /usr/lib/python3.6/dnskeybase.py <genexpr>) s r c C sL t }d}x<|dkrF| |@ r<tj|}|s2t|}|j| |dK }q W |S )zCConvert a DNSKEY flags value to set texts @rtype: set([string])r i )set_flag_by_valuegethexadd)flagsZ flags_setmasktextr r r r , s c C sH d}x>| D ]6}y|t | 7 }W q tk r> td| Y q X q W |S )zNConvert set of DNSKEY flag mnemonic texts to DNSKEY flag value @rtype: intr z!DNSKEY flag '%s' is not supported) _flag_by_textKeyErrorNotImplementedError)Z texts_setr r r r r r < s c sd e Zd ZdZddddgZ fddZdd d Zedd d ZdddZ edddZ dd Z Z S ) DNSKEYBasea? Base class for rdata that is like a DNSKEY record @ivar flags: the key flags @type flags: int @ivar protocol: the protocol for which this key may be used @type protocol: int @ivar algorithm: the algorithm used for the key @type algorithm: int @ivar key: the public key @type key: stringr protocol algorithmkeyc s. t t| j|| || _|| _|| _|| _d S )N)superr __init__r r r r )selfrdclassrdtyper r r r ) __class__r r r Y s zDNSKEYBase.__init__NTc K s d| j | j| jtjj| jf S )Nz %d %d %d %s)r r r dnsrdataZ _base64ifyr )r! origin relativizekwr r r to_text` s zDNSKEYBase.to_textc C s |j }|j }tjj|j }g } x:|j j } | j r<P | j sLtj j | j | j j q&W dj| } tj| } | |||||| S )N )Z get_uint16Z get_uint8r% ZdnssecZalgorithm_from_textZ get_stringr ZunescapeZ is_eol_or_eofZ is_identifier exception SyntaxErrorappendvalueencodejoinbase64Z b64decode) clsr" r# tokr' r( r r r ZchunkstZb64r r r r from_textd s zDNSKEYBase.from_textc C s0 t jd| j| j| j}|j| |j| j d S )Nz!HBB)structpackr r r writer )r! filecompressr' headerr r r to_wireu s zDNSKEYBase.to_wirec C sj |dk rt jjtjd|||d }|d7 }|d8 }|||| j }| |||d |d |d |S )N z!HBBr r )r% r, Z FormErrorr7 unpackZunwrap) r3 r" r# ZwireZcurrentZrdlenr' r< r r r r from_wirez s zDNSKEYBase.from_wirec C s t | jS )zGConvert a DNSKEY flags value to set texts @rtype: set([string]))r r )r! r r r r s z DNSKEYBase.flags_to_text_set)NT)NT)NN)N) __name__ __module__ __qualname____doc__ __slots__r r* classmethodr6 r= rA r __classcell__r r )r$ r r J s r )r2 r7 Z dns.exceptionr% Z dns.dnssecZ dns.rdata__all__r r r r dictitemsr r r r& ZRdatar r r r r <module> s PK g\ac c 0 rdtypes/__pycache__/euibase.cpython-36.opt-1.pycnu [ 3 bW @ s4 d dl Z d dlZd dlmZ G dd dejjZdS ) N)xrangec sV e Zd ZdZdgZ fddZdddZedd d Zdd d Z edd dZ Z S )EUIBasezEUIxx record @ivar fingerprint: xx-bit Extended Unique Identifier (EUI-xx) @type fingerprint: string @see: rfc7043.txteuic sF t t| j|| t|| jkr<tjjd| jd | jf || _d S )Nz EUI%s rdata has to have %s bytes ) superr __init__lenbyte_lendns exceptionZ FormErrorr )selfrdclassrdtyper ) __class__ /usr/lib/python3.6/euibase.pyr $ s zEUIBase.__init__NTc K s t jj| jddjddS )N )Z chunksize -)r rdataZ_hexifyr replace)r origin relativizekwr r r to_text+ s zEUIBase.to_textc C s |j }|j t|| jkr0tjjd| j td| jd d d}x(|D ] }|| dkrLtjjd| qLW |j dd}yt j |j } W n: t tfk r } ztjjdt| W Y d d } ~ X nX | ||| S ) Nz"Input text must have %s charactersr r z Dash expected at position %s zHex decoding error: %s)Z get_stringZget_eolr Ztext_lenr r SyntaxErrorr r r binasciiZ unhexlifyencode ValueError TypeErrorstr) clsr r tokr r textZexpected_dash_idxsidataZexr r r from_text. s &zEUIBase.from_textc C s |j | j d S )N)writer )r filecompressr r r r to_wireA s zEUIBase.to_wirec C s |||| j }| |||S )N)Zunwrap)r$ r r ZwireZcurrentZrdlenr r r r r from_wireD s zEUIBase.from_wire)NT)NT)NN)N) __name__ __module__ __qualname____doc__ __slots__r r classmethodr) r- r. __classcell__r r )r r r s r )r Z dns.rdatar Z dns._compatr r ZRdatar r r r r <module> s PK g\C / rdtypes/__pycache__/mxbase.cpython-36.opt-1.pycnu [ 3 bWL @ sh d Z ddlmZ ddlZddlZddlZddlZG dd dejj Z G dd de Z G dd d e Z dS ) zMX-like base classes. )BytesIONc sl e Zd ZdZddgZ fddZddd Zedd d Zdd d Z dddZ edddZ dddZ Z S )MXBasezBase class for rdata that is like an MX record. @ivar preference: the preference value @type preference: int @ivar exchange: the exchange name @type exchange: dns.name.Name object preferenceexchangec s" t t| j|| || _|| _d S )N)superr __init__r r )selfrdclassrdtyper r ) __class__ /usr/lib/python3.6/mxbase.pyr % s zMXBase.__init__NTc K s | j j||}d| j|f S )Nz%d %s)r choose_relativityr )r origin relativizekwr r r r to_text* s zMXBase.to_textc C s2 |j }|j }|j||}|j | ||||S )N)Z get_uint16Zget_namer Zget_eol)clsr r tokr r r r r r r from_text. s zMXBase.from_textc C s, t jd| j}|j| | jj||| d S )Nz!H)structpackr writer to_wire)r filecompressr Zprefr r r r 6 s zMXBase.to_wirec C s t jd| j| jj| S )Nz!H)r r r r to_digestable)r r r r r r ; s zMXBase.to_digestablec C sx t jd|||d \}|d7 }|d8 }tjj|d || |\}} | |krXtjj|d k rj|j|}| ||||S )Nz!H )r unpackdnsname from_wireZ exceptionZ FormErrorr ) r r r ZwireZcurrentZrdlenr r r Zcusedr r r r! ? s zMXBase.from_wirec C s | j j||| _ d S )N)r r )r r r r r r r L s zMXBase.choose_relativity)NT)NT)NN)N)N)NT)__name__ __module__ __qualname____doc__ __slots__r r classmethodr r r r! r __classcell__r r )r r r s r c s, e Zd ZdZd fdd ZdddZ ZS ) UncompressedMXzBase class for rdata that is like an MX record, but whose name is not compressed when converted to DNS wire format, and whose digestable form is not downcased.Nc s t t| j|d | d S )N)r r) r )r r r r )r r r r V s zUncompressedMX.to_wirec C s t }| j|d | |j S )N)r r getvalue)r r fr r r r Y s z UncompressedMX.to_digestable)NN)N)r" r# r$ r% r r r( r r )r r r) P s r) c s" e Zd ZdZd fdd Z ZS )UncompressedDowncasingMXzuBase class for rdata that is like an MX record, but whose name is not compressed when convert to DNS wire format.Nc s t t| j|d | d S )N)r r, r )r r r r )r r r r d s z UncompressedDowncasingMX.to_wire)NN)r" r# r$ r% r r( r r )r r r, _ s r, ) r% ior r Z dns.exceptionr Z dns.rdataZdns.nameZrdataZRdatar r) r, r r r r <module> s 6PK g\E / rdtypes/__pycache__/dsbase.cpython-36.opt-1.pycnu [ 3 bW @ s8 d dl Z d dlZd dlZd dlZG dd dejjZdS ) Nc s\ e Zd ZdZddddgZ fddZdd d Zedd d ZdddZ edddZ Z S )DSBaseaJ Base class for rdata that is like a DS record @ivar key_tag: the key tag @type key_tag: int @ivar algorithm: the algorithm @type algorithm: int @ivar digest_type: the digest type @type digest_type: int @ivar digest: the digest @type digest: int @see: draft-ietf-dnsext-delegation-signer-14.txtkey_tag algorithm digest_typedigestc s. t t| j|| || _|| _|| _|| _d S )N)superr __init__r r r r )selfrdclassrdtyper r r r ) __class__ /usr/lib/python3.6/dsbase.pyr ' s zDSBase.__init__NTc K s$ d| j | j| jtjj| jddf S )Nz %d %d %d %s )Z chunksize)r r r dnsrdataZ_hexifyr )r origin relativizekwr r r to_text/ s zDSBase.to_textc C s~ |j }|j }|j }g } x:|j j } | j r4P | j sDtjj| j | j j q W dj | } t j| } | |||||| S )N )Z get_uint16Z get_uint8getZunescapeZ is_eol_or_eofZ is_identifierr Z exception SyntaxErrorappendvalueencodejoinbinasciiZ unhexlify) clsr r tokr r r r r Zchunkstr r r r from_text5 s zDSBase.from_textc C s0 t jd| j| j| j}|j| |j| j d S )Nz!HBB)structpackr r r writer )r filecompressr headerr r r to_wireG s zDSBase.to_wirec C sZ t jd|||d }|d7 }|d8 }|||| j }| |||d |d |d |S )Nz!HBB r )r" unpackZunwrap) r r r ZwireZcurrentZrdlenr r' r r r r from_wireM s zDSBase.from_wire)NT)NT)NN)N) __name__ __module__ __qualname____doc__ __slots__r r classmethodr! r( r- __classcell__r r )r r r s r )r" r Z dns.rdatar Z dns.rdatatyper ZRdatar r r r r <module> s PK g\C ) rdtypes/__pycache__/mxbase.cpython-36.pycnu [ 3 bWL @ sh d Z ddlmZ ddlZddlZddlZddlZG dd dejj Z G dd de Z G dd d e Z dS ) zMX-like base classes. )BytesIONc sl e Zd ZdZddgZ fddZddd Zedd d Zdd d Z dddZ edddZ dddZ Z S )MXBasezBase class for rdata that is like an MX record. @ivar preference: the preference value @type preference: int @ivar exchange: the exchange name @type exchange: dns.name.Name object preferenceexchangec s" t t| j|| || _|| _d S )N)superr __init__r r )selfrdclassrdtyper r ) __class__ /usr/lib/python3.6/mxbase.pyr % s zMXBase.__init__NTc K s | j j||}d| j|f S )Nz%d %s)r choose_relativityr )r origin relativizekwr r r r to_text* s zMXBase.to_textc C s2 |j }|j }|j||}|j | ||||S )N)Z get_uint16Zget_namer Zget_eol)clsr r tokr r r r r r r from_text. s zMXBase.from_textc C s, t jd| j}|j| | jj||| d S )Nz!H)structpackr writer to_wire)r filecompressr Zprefr r r r 6 s zMXBase.to_wirec C s t jd| j| jj| S )Nz!H)r r r r to_digestable)r r r r r r ; s zMXBase.to_digestablec C sx t jd|||d \}|d7 }|d8 }tjj|d || |\}} | |krXtjj|d k rj|j|}| ||||S )Nz!H )r unpackdnsname from_wireZ exceptionZ FormErrorr ) r r r ZwireZcurrentZrdlenr r r Zcusedr r r r! ? s zMXBase.from_wirec C s | j j||| _ d S )N)r r )r r r r r r r L s zMXBase.choose_relativity)NT)NT)NN)N)N)NT)__name__ __module__ __qualname____doc__ __slots__r r classmethodr r r r! r __classcell__r r )r r r s r c s, e Zd ZdZd fdd ZdddZ ZS ) UncompressedMXzBase class for rdata that is like an MX record, but whose name is not compressed when converted to DNS wire format, and whose digestable form is not downcased.Nc s t t| j|d | d S )N)r r) r )r r r r )r r r r V s zUncompressedMX.to_wirec C s t }| j|d | |j S )N)r r getvalue)r r fr r r r Y s z UncompressedMX.to_digestable)NN)N)r" r# r$ r% r r r( r r )r r r) P s r) c s" e Zd ZdZd fdd Z ZS )UncompressedDowncasingMXzuBase class for rdata that is like an MX record, but whose name is not compressed when convert to DNS wire format.Nc s t t| j|d | d S )N)r r, r )r r r r )r r r r d s z UncompressedDowncasingMX.to_wire)NN)r" r# r$ r% r r( r r )r r r, _ s r, ) r% ior r Z dns.exceptionr Z dns.rdataZdns.nameZrdataZRdatar r) r, r r r r <module> s 6PK g\V5 5 3 rdtypes/__pycache__/dnskeybase.cpython-36.opt-1.pycnu [ 3 bW# @ s d dl Z d dlZd dlZd dlZd dlZdddddgZdZdZd Z eee d Z e d d e j D Z d d Zdd ZG dd dejjZdS ) NSEPREVOKEZONEflags_to_text_setflags_from_text_set )r r r c c s | ]\}}||fV qd S )N ).0xyr r /usr/lib/python3.6/dnskeybase.py <genexpr>) s r c C sL t }d}x<|dkrF| |@ r<tj|}|s2t|}|j| |dK }q W |S )zCConvert a DNSKEY flags value to set texts @rtype: set([string])r i )set_flag_by_valuegethexadd)flagsZ flags_setmasktextr r r r , s c C sH d}x>| D ]6}y|t | 7 }W q tk r> td| Y q X q W |S )zNConvert set of DNSKEY flag mnemonic texts to DNSKEY flag value @rtype: intr z!DNSKEY flag '%s' is not supported) _flag_by_textKeyErrorNotImplementedError)Z texts_setr r r r r r < s c sd e Zd ZdZddddgZ fddZdd d Zedd d ZdddZ edddZ dd Z Z S ) DNSKEYBasea? Base class for rdata that is like a DNSKEY record @ivar flags: the key flags @type flags: int @ivar protocol: the protocol for which this key may be used @type protocol: int @ivar algorithm: the algorithm used for the key @type algorithm: int @ivar key: the public key @type key: stringr protocol algorithmkeyc s. t t| j|| || _|| _|| _|| _d S )N)superr __init__r r r r )selfrdclassrdtyper r r r ) __class__r r r Y s zDNSKEYBase.__init__NTc K s d| j | j| jtjj| jf S )Nz %d %d %d %s)r r r dnsrdataZ _base64ifyr )r! origin relativizekwr r r to_text` s zDNSKEYBase.to_textc C s |j }|j }tjj|j }g } x:|j j } | j r<P | j sLtj j | j | j j q&W dj| } tj| } | |||||| S )N )Z get_uint16Z get_uint8r% ZdnssecZalgorithm_from_textZ get_stringr ZunescapeZ is_eol_or_eofZ is_identifier exception SyntaxErrorappendvalueencodejoinbase64Z b64decode) clsr" r# tokr' r( r r r ZchunkstZb64r r r r from_textd s zDNSKEYBase.from_textc C s0 t jd| j| j| j}|j| |j| j d S )Nz!HBB)structpackr r r writer )r! filecompressr' headerr r r to_wireu s zDNSKEYBase.to_wirec C sj |dk rt jjtjd|||d }|d7 }|d8 }|||| j }| |||d |d |d |S )N z!HBBr r )r% r, Z FormErrorr7 unpackZunwrap) r3 r" r# ZwireZcurrentZrdlenr' r< r r r r from_wirez s zDNSKEYBase.from_wirec C s t | jS )zGConvert a DNSKEY flags value to set texts @rtype: set([string]))r r )r! r r r r s z DNSKEYBase.flags_to_text_set)NT)NT)NN)N) __name__ __module__ __qualname____doc__ __slots__r r* classmethodr6 r= rA r __classcell__r r )r$ r r J s r )r2 r7 Z dns.exceptionr% Z dns.dnssecZ dns.rdata__all__r r r r dictitemsr r r r& ZRdatar r r r r <module> s PK g\v~u u / rdtypes/__pycache__/nsbase.cpython-36.opt-1.pycnu [ 3 bW# @ sP d Z ddlmZ ddlZddlZddlZG dd dejjZ G dd de Z dS )zNS-like base classes. )BytesIONc sj e Zd ZdZdgZ fddZdddZedd d Zdd d Z dd dZ edddZ dddZ Z S )NSBasezBase class for rdata that is like an NS record. @ivar target: the target name of the rdata @type target: dns.name.Name objecttargetc s t t| j|| || _d S )N)superr __init__r )selfrdclassrdtyper ) __class__ /usr/lib/python3.6/nsbase.pyr " s zNSBase.__init__NTc K s | j j||}t|S )N)r choose_relativitystr)r origin relativizekwr r r r to_text& s zNSBase.to_textc C s( |j }|j||}|j | |||S )N)Zget_namer Zget_eol)clsr r tokr r r r r r from_text* s zNSBase.from_textc C s | j j||| d S )N)r to_wire)r filecompressr r r r r 1 s zNSBase.to_wirec C s | j j|S )N)r to_digestable)r r r r r r 4 s zNSBase.to_digestablec C sL t jj|d || |\}}||kr.t jj|d k r@|j|}| |||S )N)dnsname from_wireZ exceptionZ FormErrorr ) r r r ZwireZcurrentZrdlenr r Zcusedr r r r 7 s zNSBase.from_wirec C s | j j||| _ d S )N)r r )r r r r r r r A s zNSBase.choose_relativity)NT)NT)NN)N)N)NT)__name__ __module__ __qualname____doc__ __slots__r r classmethodr r r r r __classcell__r r )r r r s r c s, e Zd ZdZd fdd ZdddZ ZS ) UncompressedNSzBase class for rdata that is like an NS record, but whose name is not compressed when convert to DNS wire format, and whose digestable form is not downcased.Nc s t t| j|d | d S )N)r r$ r )r r r r )r r r r K s zUncompressedNS.to_wirec C s t }| j|d | |j S )N)r r getvalue)r r fr r r r N s z UncompressedNS.to_digestable)NN)N)r r r r r r r# r r )r r r$ E s r$ ) r ior Z dns.exceptionr Z dns.rdataZdns.nameZrdataZRdatar r$ r r r r <module> s ,PK g\B1 * rdtypes/__pycache__/txtbase.cpython-36.pycnu [ 3 bW @ sH d Z ddlZddlZddlZddlZddlmZ G dd dejj Z dS )zTXT-like base class. N) binary_typec sV e Zd ZdZdgZ fddZdddZedd d Zdd d Z edd dZ Z S )TXTBasezBase class for rdata that is like a TXT record @ivar strings: the text strings @type strings: list of string @see: RFC 1035stringsc s4 t t| j|| t|tr"|g}|d d | _d S )N)superr __init__ isinstancestrr )selfrdclassrdtyper ) __class__ /usr/lib/python3.6/txtbase.pyr $ s zTXTBase.__init__NTc K s8 d}d}x*| j D ] }|d|tjj|f 7 }d}qW |S )N z%s"%s" )r dnsrdataZ _escapify)r origin relativizekwZtxtprefixsr r r to_text* s zTXTBase.to_textc C s g }xz|j j }|j r P |j p*|j s8tjjdt|j dkrRtjjd|j }t |t rn|j | q|j |j qW t|dkrtjj| |||S )Nzexpected a string zstring too longr )getZunescapeZ is_eol_or_eofZis_quoted_stringZ is_identifierr exception SyntaxErrorlenvaluer r appendencodeZ UnexpectedEnd) clsr r tokr r r tokenr r r r from_text2 s zTXTBase.from_textc C sD x>| j D ]4}t|}|dk s t|jtjd| |j| qW d S )N z!B)r r AssertionErrorwritestructpack)r filecompressr r lr r r to_wireF s zTXTBase.to_wirec C st g }xb|dkrf|| }|d7 }|d8 }||kr6t jj|||| j } ||7 }||8 }|j| qW | |||S )Nr )r r Z FormErrorZunwrapr ) r! r r ZwireZcurrentZrdlenr r r, r r r r from_wireM s zTXTBase.from_wire)NT)NT)NN)N) __name__ __module__ __qualname____doc__ __slots__r r classmethodr$ r- r/ __classcell__r r )r r r s r ) r3 r( Z dns.exceptionr Z dns.rdataZ dns.tokenizerZ dns._compatr r ZRdatar r r r r <module> s PK g\t 0 rdtypes/__pycache__/txtbase.cpython-36.opt-1.pycnu [ 3 bW @ sH d Z ddlZddlZddlZddlZddlmZ G dd dejj Z dS )zTXT-like base class. N) binary_typec sV e Zd ZdZdgZ fddZdddZedd d Zdd d Z edd dZ Z S )TXTBasezBase class for rdata that is like a TXT record @ivar strings: the text strings @type strings: list of string @see: RFC 1035stringsc s4 t t| j|| t|tr"|g}|d d | _d S )N)superr __init__ isinstancestrr )selfrdclassrdtyper ) __class__ /usr/lib/python3.6/txtbase.pyr $ s zTXTBase.__init__NTc K s8 d}d}x*| j D ] }|d|tjj|f 7 }d}qW |S )N z%s"%s" )r dnsrdataZ _escapify)r origin relativizekwZtxtprefixsr r r to_text* s zTXTBase.to_textc C s g }xz|j j }|j r P |j p*|j s8tjjdt|j dkrRtjjd|j }t |t rn|j | q|j |j qW t|dkrtjj| |||S )Nzexpected a string zstring too longr )getZunescapeZ is_eol_or_eofZis_quoted_stringZ is_identifierr exception SyntaxErrorlenvaluer r appendencodeZ UnexpectedEnd) clsr r tokr r r tokenr r r r from_text2 s zTXTBase.from_textc C s8 x2| j D ](}t|}|jtjd| |j| qW d S )Nz!B)r r writestructpack)r filecompressr r lr r r to_wireF s zTXTBase.to_wirec C st g }xb|dkrf|| }|d7 }|d8 }||kr6t jj|||| j } ||7 }||8 }|j| qW | |||S )Nr )r r Z FormErrorZunwrapr ) r! r r ZwireZcurrentZrdlenr r r* r r r r from_wireM s zTXTBase.from_wire)NT)NT)NN)N) __name__ __module__ __qualname____doc__ __slots__r r classmethodr$ r+ r- __classcell__r r )r r r s r ) r1 r& Z dns.exceptionr Z dns.rdataZ dns.tokenizerZ dns._compatr r ZRdatar r r r r <module> s PK g\E ) rdtypes/__pycache__/dsbase.cpython-36.pycnu [ 3 bW @ s8 d dl Z d dlZd dlZd dlZG dd dejjZdS ) Nc s\ e Zd ZdZddddgZ fddZdd d Zedd d ZdddZ edddZ Z S )DSBaseaJ Base class for rdata that is like a DS record @ivar key_tag: the key tag @type key_tag: int @ivar algorithm: the algorithm @type algorithm: int @ivar digest_type: the digest type @type digest_type: int @ivar digest: the digest @type digest: int @see: draft-ietf-dnsext-delegation-signer-14.txtkey_tag algorithm digest_typedigestc s. t t| j|| || _|| _|| _|| _d S )N)superr __init__r r r r )selfrdclassrdtyper r r r ) __class__ /usr/lib/python3.6/dsbase.pyr ' s zDSBase.__init__NTc K s$ d| j | j| jtjj| jddf S )Nz %d %d %d %s )Z chunksize)r r r dnsrdataZ_hexifyr )r origin relativizekwr r r to_text/ s zDSBase.to_textc C s~ |j }|j }|j }g } x:|j j } | j r4P | j sDtjj| j | j j q W dj | } t j| } | |||||| S )N )Z get_uint16Z get_uint8getZunescapeZ is_eol_or_eofZ is_identifierr Z exception SyntaxErrorappendvalueencodejoinbinasciiZ unhexlify) clsr r tokr r r r r Zchunkstr r r r from_text5 s zDSBase.from_textc C s0 t jd| j| j| j}|j| |j| j d S )Nz!HBB)structpackr r r writer )r filecompressr headerr r r to_wireG s zDSBase.to_wirec C sZ t jd|||d }|d7 }|d8 }|||| j }| |||d |d |d |S )Nz!HBB r )r" unpackZunwrap) r r r ZwireZcurrentZrdlenr r' r r r r from_wireM s zDSBase.from_wire)NT)NT)NN)N) __name__ __module__ __qualname____doc__ __slots__r r classmethodr! r( r- __classcell__r r )r r r s r )r" r Z dns.rdatar Z dns.rdatatyper ZRdatar r r r r <module> s PK g\z\J 1 rdtypes/__pycache__/__init__.cpython-36.opt-1.pycnu [ 3 bW @ s d Z dddddgZdS )zDNS rdata type classesANYINZeuibaseZmxbaseZnsbaseN)__doc____all__ r r /usr/lib/python3.6/__init__.py<module> s PK g\z\J + rdtypes/__pycache__/__init__.cpython-36.pycnu [ 3 bW @ s d Z dddddgZdS )zDNS rdata type classesANYINZeuibaseZmxbaseZnsbaseN)__doc____all__ r r /usr/lib/python3.6/__init__.py<module> s PK g\eB rdtypes/dsbase.pynu [ # Copyright (C) 2010, 2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. import struct import binascii import dns.rdata import dns.rdatatype class DSBase(dns.rdata.Rdata): """Base class for rdata that is like a DS record @ivar key_tag: the key tag @type key_tag: int @ivar algorithm: the algorithm @type algorithm: int @ivar digest_type: the digest type @type digest_type: int @ivar digest: the digest @type digest: int @see: draft-ietf-dnsext-delegation-signer-14.txt""" __slots__ = ['key_tag', 'algorithm', 'digest_type', 'digest'] def __init__(self, rdclass, rdtype, key_tag, algorithm, digest_type, digest): super(DSBase, self).__init__(rdclass, rdtype) self.key_tag = key_tag self.algorithm = algorithm self.digest_type = digest_type self.digest = digest def to_text(self, origin=None, relativize=True, **kw): return '%d %d %d %s' % (self.key_tag, self.algorithm, self.digest_type, dns.rdata._hexify(self.digest, chunksize=128)) @classmethod def from_text(cls, rdclass, rdtype, tok, origin=None, relativize=True): key_tag = tok.get_uint16() algorithm = tok.get_uint8() digest_type = tok.get_uint8() chunks = [] while 1: t = tok.get().unescape() if t.is_eol_or_eof(): break if not t.is_identifier(): raise dns.exception.SyntaxError chunks.append(t.value.encode()) digest = b''.join(chunks) digest = binascii.unhexlify(digest) return cls(rdclass, rdtype, key_tag, algorithm, digest_type, digest) def to_wire(self, file, compress=None, origin=None): header = struct.pack("!HBB", self.key_tag, self.algorithm, self.digest_type) file.write(header) file.write(self.digest) @classmethod def from_wire(cls, rdclass, rdtype, wire, current, rdlen, origin=None): header = struct.unpack("!HBB", wire[current: current + 4]) current += 4 rdlen -= 4 digest = wire[current: current + rdlen].unwrap() return cls(rdclass, rdtype, header[0], header[1], header[2], digest) PK g\! rdtypes/txtbase.pynu [ # Copyright (C) 2006, 2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. """TXT-like base class.""" import struct import dns.exception import dns.rdata import dns.tokenizer from dns._compat import binary_type class TXTBase(dns.rdata.Rdata): """Base class for rdata that is like a TXT record @ivar strings: the text strings @type strings: list of string @see: RFC 1035""" __slots__ = ['strings'] def __init__(self, rdclass, rdtype, strings): super(TXTBase, self).__init__(rdclass, rdtype) if isinstance(strings, str): strings = [strings] self.strings = strings[:] def to_text(self, origin=None, relativize=True, **kw): txt = '' prefix = '' for s in self.strings: txt += '%s"%s"' % (prefix, dns.rdata._escapify(s)) prefix = ' ' return txt @classmethod def from_text(cls, rdclass, rdtype, tok, origin=None, relativize=True): strings = [] while 1: token = tok.get().unescape() if token.is_eol_or_eof(): break if not (token.is_quoted_string() or token.is_identifier()): raise dns.exception.SyntaxError("expected a string") if len(token.value) > 255: raise dns.exception.SyntaxError("string too long") value = token.value if isinstance(value, binary_type): strings.append(value) else: strings.append(value.encode()) if len(strings) == 0: raise dns.exception.UnexpectedEnd return cls(rdclass, rdtype, strings) def to_wire(self, file, compress=None, origin=None): for s in self.strings: l = len(s) assert l < 256 file.write(struct.pack('!B', l)) file.write(s) @classmethod def from_wire(cls, rdclass, rdtype, wire, current, rdlen, origin=None): strings = [] while rdlen > 0: l = wire[current] current += 1 rdlen -= 1 if l > rdlen: raise dns.exception.FormError s = wire[current: current + l].unwrap() current += l rdlen -= l strings.append(s) return cls(rdclass, rdtype, strings) PK g\j_[ rdtypes/__init__.pynu [ # Copyright (C) 2003-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. """DNS rdata type classes""" __all__ = [ 'ANY', 'IN', 'euibase', 'mxbase', 'nsbase', ] PK g\$# # rdtypes/dnskeybase.pynu [ # Copyright (C) 2004-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. import base64 import struct import dns.exception import dns.dnssec import dns.rdata # wildcard import __all__ = ["SEP", "REVOKE", "ZONE", "flags_to_text_set", "flags_from_text_set"] # flag constants SEP = 0x0001 REVOKE = 0x0080 ZONE = 0x0100 _flag_by_text = { 'SEP': SEP, 'REVOKE': REVOKE, 'ZONE': ZONE } # We construct the inverse mapping programmatically to ensure that we # cannot make any mistakes (e.g. omissions, cut-and-paste errors) that # would cause the mapping not to be true inverse. _flag_by_value = dict((y, x) for x, y in _flag_by_text.items()) def flags_to_text_set(flags): """Convert a DNSKEY flags value to set texts @rtype: set([string])""" flags_set = set() mask = 0x1 while mask <= 0x8000: if flags & mask: text = _flag_by_value.get(mask) if not text: text = hex(mask) flags_set.add(text) mask <<= 1 return flags_set def flags_from_text_set(texts_set): """Convert set of DNSKEY flag mnemonic texts to DNSKEY flag value @rtype: int""" flags = 0 for text in texts_set: try: flags += _flag_by_text[text] except KeyError: raise NotImplementedError( "DNSKEY flag '%s' is not supported" % text) return flags class DNSKEYBase(dns.rdata.Rdata): """Base class for rdata that is like a DNSKEY record @ivar flags: the key flags @type flags: int @ivar protocol: the protocol for which this key may be used @type protocol: int @ivar algorithm: the algorithm used for the key @type algorithm: int @ivar key: the public key @type key: string""" __slots__ = ['flags', 'protocol', 'algorithm', 'key'] def __init__(self, rdclass, rdtype, flags, protocol, algorithm, key): super(DNSKEYBase, self).__init__(rdclass, rdtype) self.flags = flags self.protocol = protocol self.algorithm = algorithm self.key = key def to_text(self, origin=None, relativize=True, **kw): return '%d %d %d %s' % (self.flags, self.protocol, self.algorithm, dns.rdata._base64ify(self.key)) @classmethod def from_text(cls, rdclass, rdtype, tok, origin=None, relativize=True): flags = tok.get_uint16() protocol = tok.get_uint8() algorithm = dns.dnssec.algorithm_from_text(tok.get_string()) chunks = [] while 1: t = tok.get().unescape() if t.is_eol_or_eof(): break if not t.is_identifier(): raise dns.exception.SyntaxError chunks.append(t.value.encode()) b64 = b''.join(chunks) key = base64.b64decode(b64) return cls(rdclass, rdtype, flags, protocol, algorithm, key) def to_wire(self, file, compress=None, origin=None): header = struct.pack("!HBB", self.flags, self.protocol, self.algorithm) file.write(header) file.write(self.key) @classmethod def from_wire(cls, rdclass, rdtype, wire, current, rdlen, origin=None): if rdlen < 4: raise dns.exception.FormError header = struct.unpack('!HBB', wire[current: current + 4]) current += 4 rdlen -= 4 key = wire[current: current + rdlen].unwrap() return cls(rdclass, rdtype, header[0], header[1], header[2], key) def flags_to_text_set(self): """Convert a DNSKEY flags value to set texts @rtype: set([string])""" return flags_to_text_set(self.flags) PK g\ @eL L rdtypes/mxbase.pynu [ # Copyright (C) 2003-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. """MX-like base classes.""" from io import BytesIO import struct import dns.exception import dns.rdata import dns.name class MXBase(dns.rdata.Rdata): """Base class for rdata that is like an MX record. @ivar preference: the preference value @type preference: int @ivar exchange: the exchange name @type exchange: dns.name.Name object""" __slots__ = ['preference', 'exchange'] def __init__(self, rdclass, rdtype, preference, exchange): super(MXBase, self).__init__(rdclass, rdtype) self.preference = preference self.exchange = exchange def to_text(self, origin=None, relativize=True, **kw): exchange = self.exchange.choose_relativity(origin, relativize) return '%d %s' % (self.preference, exchange) @classmethod def from_text(cls, rdclass, rdtype, tok, origin=None, relativize=True): preference = tok.get_uint16() exchange = tok.get_name() exchange = exchange.choose_relativity(origin, relativize) tok.get_eol() return cls(rdclass, rdtype, preference, exchange) def to_wire(self, file, compress=None, origin=None): pref = struct.pack("!H", self.preference) file.write(pref) self.exchange.to_wire(file, compress, origin) def to_digestable(self, origin=None): return struct.pack("!H", self.preference) + \ self.exchange.to_digestable(origin) @classmethod def from_wire(cls, rdclass, rdtype, wire, current, rdlen, origin=None): (preference, ) = struct.unpack('!H', wire[current: current + 2]) current += 2 rdlen -= 2 (exchange, cused) = dns.name.from_wire(wire[: current + rdlen], current) if cused != rdlen: raise dns.exception.FormError if origin is not None: exchange = exchange.relativize(origin) return cls(rdclass, rdtype, preference, exchange) def choose_relativity(self, origin=None, relativize=True): self.exchange = self.exchange.choose_relativity(origin, relativize) class UncompressedMX(MXBase): """Base class for rdata that is like an MX record, but whose name is not compressed when converted to DNS wire format, and whose digestable form is not downcased.""" def to_wire(self, file, compress=None, origin=None): super(UncompressedMX, self).to_wire(file, None, origin) def to_digestable(self, origin=None): f = BytesIO() self.to_wire(f, None, origin) return f.getvalue() class UncompressedDowncasingMX(MXBase): """Base class for rdata that is like an MX record, but whose name is not compressed when convert to DNS wire format.""" def to_wire(self, file, compress=None, origin=None): super(UncompressedDowncasingMX, self).to_wire(file, None, origin) PK g\ z<# # rdtypes/nsbase.pynu [ # Copyright (C) 2003-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. """NS-like base classes.""" from io import BytesIO import dns.exception import dns.rdata import dns.name class NSBase(dns.rdata.Rdata): """Base class for rdata that is like an NS record. @ivar target: the target name of the rdata @type target: dns.name.Name object""" __slots__ = ['target'] def __init__(self, rdclass, rdtype, target): super(NSBase, self).__init__(rdclass, rdtype) self.target = target def to_text(self, origin=None, relativize=True, **kw): target = self.target.choose_relativity(origin, relativize) return str(target) @classmethod def from_text(cls, rdclass, rdtype, tok, origin=None, relativize=True): target = tok.get_name() target = target.choose_relativity(origin, relativize) tok.get_eol() return cls(rdclass, rdtype, target) def to_wire(self, file, compress=None, origin=None): self.target.to_wire(file, compress, origin) def to_digestable(self, origin=None): return self.target.to_digestable(origin) @classmethod def from_wire(cls, rdclass, rdtype, wire, current, rdlen, origin=None): (target, cused) = dns.name.from_wire(wire[: current + rdlen], current) if cused != rdlen: raise dns.exception.FormError if origin is not None: target = target.relativize(origin) return cls(rdclass, rdtype, target) def choose_relativity(self, origin=None, relativize=True): self.target = self.target.choose_relativity(origin, relativize) class UncompressedNS(NSBase): """Base class for rdata that is like an NS record, but whose name is not compressed when convert to DNS wire format, and whose digestable form is not downcased.""" def to_wire(self, file, compress=None, origin=None): super(UncompressedNS, self).to_wire(file, None, origin) def to_digestable(self, origin=None): f = BytesIO() self.to_wire(f, None, origin) return f.getvalue() PK g\9/ / __init__.pynu [ # Copyright (C) 2003-2007, 2009, 2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. """dnspython DNS toolkit""" __all__ = [ 'dnssec', 'e164', 'edns', 'entropy', 'exception', 'flags', 'hash', 'inet', 'ipv4', 'ipv6', 'message', 'name', 'namedict', 'node', 'opcode', 'query', 'rcode', 'rdata', 'rdataclass', 'rdataset', 'rdatatype', 'renderer', 'resolver', 'reversename', 'rrset', 'set', 'tokenizer', 'tsig', 'tsigkeyring', 'ttl', 'rdtypes', 'update', 'version', 'wiredata', 'zone', ] PK g\ H> rdatatype.pynu [ # Copyright (C) 2001-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. """DNS Rdata Types. @var _by_text: The rdata type textual name to value mapping @type _by_text: dict @var _by_value: The rdata type value to textual name mapping @type _by_value: dict @var _metatypes: If an rdatatype is a metatype, there will be a mapping whose key is the rdatatype value and whose value is True in this dictionary. @type _metatypes: dict @var _singletons: If an rdatatype is a singleton, there will be a mapping whose key is the rdatatype value and whose value is True in this dictionary. @type _singletons: dict""" import re import dns.exception NONE = 0 A = 1 NS = 2 MD = 3 MF = 4 CNAME = 5 SOA = 6 MB = 7 MG = 8 MR = 9 NULL = 10 WKS = 11 PTR = 12 HINFO = 13 MINFO = 14 MX = 15 TXT = 16 RP = 17 AFSDB = 18 X25 = 19 ISDN = 20 RT = 21 NSAP = 22 NSAP_PTR = 23 SIG = 24 KEY = 25 PX = 26 GPOS = 27 AAAA = 28 LOC = 29 NXT = 30 SRV = 33 NAPTR = 35 KX = 36 CERT = 37 A6 = 38 DNAME = 39 OPT = 41 APL = 42 DS = 43 SSHFP = 44 IPSECKEY = 45 RRSIG = 46 NSEC = 47 DNSKEY = 48 DHCID = 49 NSEC3 = 50 NSEC3PARAM = 51 TLSA = 52 HIP = 55 CDS = 59 CDNSKEY = 60 CSYNC = 62 SPF = 99 UNSPEC = 103 EUI48 = 108 EUI64 = 109 TKEY = 249 TSIG = 250 IXFR = 251 AXFR = 252 MAILB = 253 MAILA = 254 ANY = 255 URI = 256 CAA = 257 AVC = 258 TA = 32768 DLV = 32769 _by_text = { 'NONE': NONE, 'A': A, 'NS': NS, 'MD': MD, 'MF': MF, 'CNAME': CNAME, 'SOA': SOA, 'MB': MB, 'MG': MG, 'MR': MR, 'NULL': NULL, 'WKS': WKS, 'PTR': PTR, 'HINFO': HINFO, 'MINFO': MINFO, 'MX': MX, 'TXT': TXT, 'RP': RP, 'AFSDB': AFSDB, 'X25': X25, 'ISDN': ISDN, 'RT': RT, 'NSAP': NSAP, 'NSAP-PTR': NSAP_PTR, 'SIG': SIG, 'KEY': KEY, 'PX': PX, 'GPOS': GPOS, 'AAAA': AAAA, 'LOC': LOC, 'NXT': NXT, 'SRV': SRV, 'NAPTR': NAPTR, 'KX': KX, 'CERT': CERT, 'A6': A6, 'DNAME': DNAME, 'OPT': OPT, 'APL': APL, 'DS': DS, 'SSHFP': SSHFP, 'IPSECKEY': IPSECKEY, 'RRSIG': RRSIG, 'NSEC': NSEC, 'DNSKEY': DNSKEY, 'DHCID': DHCID, 'NSEC3': NSEC3, 'NSEC3PARAM': NSEC3PARAM, 'TLSA': TLSA, 'HIP': HIP, 'CDS': CDS, 'CDNSKEY': CDNSKEY, 'CSYNC': CSYNC, 'SPF': SPF, 'UNSPEC': UNSPEC, 'EUI48': EUI48, 'EUI64': EUI64, 'TKEY': TKEY, 'TSIG': TSIG, 'IXFR': IXFR, 'AXFR': AXFR, 'MAILB': MAILB, 'MAILA': MAILA, 'ANY': ANY, 'URI': URI, 'CAA': CAA, 'AVC': AVC, 'TA': TA, 'DLV': DLV, } # We construct the inverse mapping programmatically to ensure that we # cannot make any mistakes (e.g. omissions, cut-and-paste errors) that # would cause the mapping not to be true inverse. _by_value = dict((y, x) for x, y in _by_text.items()) _metatypes = { OPT: True } _singletons = { SOA: True, NXT: True, DNAME: True, NSEC: True, # CNAME is technically a singleton, but we allow multiple CNAMEs. } _unknown_type_pattern = re.compile('TYPE([0-9]+)$', re.I) class UnknownRdatatype(dns.exception.DNSException): """DNS resource record type is unknown.""" def from_text(text): """Convert text into a DNS rdata type value. @param text: the text @type text: string @raises dns.rdatatype.UnknownRdatatype: the type is unknown @raises ValueError: the rdata type value is not >= 0 and <= 65535 @rtype: int""" value = _by_text.get(text.upper()) if value is None: match = _unknown_type_pattern.match(text) if match is None: raise UnknownRdatatype value = int(match.group(1)) if value < 0 or value > 65535: raise ValueError("type must be between >= 0 and <= 65535") return value def to_text(value): """Convert a DNS rdata type to text. @param value: the rdata type value @type value: int @raises ValueError: the rdata type value is not >= 0 and <= 65535 @rtype: string""" if value < 0 or value > 65535: raise ValueError("type must be between >= 0 and <= 65535") text = _by_value.get(value) if text is None: text = 'TYPE' + repr(value) return text def is_metatype(rdtype): """True if the type is a metatype. @param rdtype: the type @type rdtype: int @rtype: bool""" if rdtype >= TKEY and rdtype <= ANY or rdtype in _metatypes: return True return False def is_singleton(rdtype): """True if the type is a singleton. @param rdtype: the type @type rdtype: int @rtype: bool""" if rdtype in _singletons: return True return False PK g\/L L query.pynu [ # Copyright (C) 2003-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. """Talk to a DNS server.""" from __future__ import generators import errno import select import socket import struct import sys import time import dns.exception import dns.inet import dns.name import dns.message import dns.rdataclass import dns.rdatatype from ._compat import long, string_types if sys.version_info > (3,): select_error = OSError else: select_error = select.error # Function used to create a socket. Can be overridden if needed in special # situations. socket_factory = socket.socket class UnexpectedSource(dns.exception.DNSException): """A DNS query response came from an unexpected address or port.""" class BadResponse(dns.exception.FormError): """A DNS query response does not respond to the question asked.""" def _compute_expiration(timeout): if timeout is None: return None else: return time.time() + timeout def _poll_for(fd, readable, writable, error, timeout): """Poll polling backend. @param fd: File descriptor @type fd: int @param readable: Whether to wait for readability @type readable: bool @param writable: Whether to wait for writability @type writable: bool @param timeout: Deadline timeout (expiration time, in seconds) @type timeout: float @return True on success, False on timeout """ event_mask = 0 if readable: event_mask |= select.POLLIN if writable: event_mask |= select.POLLOUT if error: event_mask |= select.POLLERR pollable = select.poll() pollable.register(fd, event_mask) if timeout: event_list = pollable.poll(long(timeout * 1000)) else: event_list = pollable.poll() return bool(event_list) def _select_for(fd, readable, writable, error, timeout): """Select polling backend. @param fd: File descriptor @type fd: int @param readable: Whether to wait for readability @type readable: bool @param writable: Whether to wait for writability @type writable: bool @param timeout: Deadline timeout (expiration time, in seconds) @type timeout: float @return True on success, False on timeout """ rset, wset, xset = [], [], [] if readable: rset = [fd] if writable: wset = [fd] if error: xset = [fd] if timeout is None: (rcount, wcount, xcount) = select.select(rset, wset, xset) else: (rcount, wcount, xcount) = select.select(rset, wset, xset, timeout) return bool((rcount or wcount or xcount)) def _wait_for(fd, readable, writable, error, expiration): done = False while not done: if expiration is None: timeout = None else: timeout = expiration - time.time() if timeout <= 0.0: raise dns.exception.Timeout try: if not _polling_backend(fd, readable, writable, error, timeout): raise dns.exception.Timeout except select_error as e: if e.args[0] != errno.EINTR: raise e done = True def _set_polling_backend(fn): """ Internal API. Do not use. """ global _polling_backend _polling_backend = fn if hasattr(select, 'poll'): # Prefer poll() on platforms that support it because it has no # limits on the maximum value of a file descriptor (plus it will # be more efficient for high values). _polling_backend = _poll_for else: _polling_backend = _select_for def _wait_for_readable(s, expiration): _wait_for(s, True, False, True, expiration) def _wait_for_writable(s, expiration): _wait_for(s, False, True, True, expiration) def _addresses_equal(af, a1, a2): # Convert the first value of the tuple, which is a textual format # address into binary form, so that we are not confused by different # textual representations of the same address n1 = dns.inet.inet_pton(af, a1[0]) n2 = dns.inet.inet_pton(af, a2[0]) return n1 == n2 and a1[1:] == a2[1:] def _matches_destination(af, from_address, destination, ignore_unexpected): # Check that from_address is appropriate for a response to a query # sent to destination. if not destination: return True if _addresses_equal(af, from_address, destination) or ( dns.inet.is_multicast(destination[0]) and from_address[1:] == destination[1:] ): return True elif ignore_unexpected: return False raise UnexpectedSource( f"got a response from {from_address} instead of " f"{destination}" ) def _destination_and_source(af, where, port, source, source_port): # Apply defaults and compute destination and source tuples # suitable for use in connect(), sendto(), or bind(). if af is None: try: af = dns.inet.af_for_address(where) except Exception: af = dns.inet.AF_INET if af == dns.inet.AF_INET: destination = (where, port) if source is not None or source_port != 0: if source is None: source = '0.0.0.0' source = (source, source_port) elif af == dns.inet.AF_INET6: destination = (where, port, 0, 0) if source is not None or source_port != 0: if source is None: source = '::' source = (source, source_port, 0, 0) return (af, destination, source) def udp(q, where, timeout=None, port=53, af=None, source=None, source_port=0, ignore_unexpected=False, one_rr_per_rrset=False, ignore_errors=False): """Return the response obtained after sending a query via UDP. @param q: the query @type q: dns.message.Message @param where: where to send the message @type where: string containing an IPv4 or IPv6 address @param timeout: The number of seconds to wait before the query times out. If None, the default, wait forever. @type timeout: float @param port: The port to which to send the message. The default is 53. @type port: int @param af: the address family to use. The default is None, which causes the address family to use to be inferred from the form of where. If the inference attempt fails, AF_INET is used. @type af: int @rtype: dns.message.Message object @param source: source address. The default is the wildcard address. @type source: string @param source_port: The port from which to send the message. The default is 0. @type source_port: int @param ignore_unexpected: If True, ignore responses from unexpected sources. The default is False. @type ignore_unexpected: bool @param one_rr_per_rrset: Put each RR into its own RRset @type one_rr_per_rrset: bool """ wire = q.to_wire() (af, destination, source) = _destination_and_source(af, where, port, source, source_port) s = socket_factory(af, socket.SOCK_DGRAM, 0) begin_time = None try: expiration = _compute_expiration(timeout) s.setblocking(0) if source is not None: s.bind(source) _wait_for_writable(s, expiration) begin_time = time.time() s.sendto(wire, destination) while 1: _wait_for_readable(s, expiration) (wire, from_address) = s.recvfrom(65535) if not _matches_destination( s.family, from_address, destination, ignore_unexpected ): continue response_time = time.time() - begin_time try: r = dns.message.from_wire(wire, keyring=q.keyring, request_mac=q.mac, one_rr_per_rrset=one_rr_per_rrset) r.time = response_time except Exception: if ignore_errors: continue else: raise if q.is_response(r): return r else: if ignore_errors: continue else: raise BadResponse finally: s.close() def _net_read(sock, count, expiration): """Read the specified number of bytes from sock. Keep trying until we either get the desired amount, or we hit EOF. A Timeout exception will be raised if the operation is not completed by the expiration time. """ s = b'' while count > 0: _wait_for_readable(sock, expiration) n = sock.recv(count) if n == b'': raise EOFError count = count - len(n) s = s + n return s def _net_write(sock, data, expiration): """Write the specified data to the socket. A Timeout exception will be raised if the operation is not completed by the expiration time. """ current = 0 l = len(data) while current < l: _wait_for_writable(sock, expiration) current += sock.send(data[current:]) def _connect(s, address): try: s.connect(address) except socket.error: (ty, v) = sys.exc_info()[:2] if hasattr(v, 'errno'): v_err = v.errno else: v_err = v[0] if v_err not in [errno.EINPROGRESS, errno.EWOULDBLOCK, errno.EALREADY]: raise v def tcp(q, where, timeout=None, port=53, af=None, source=None, source_port=0, one_rr_per_rrset=False): """Return the response obtained after sending a query via TCP. @param q: the query @type q: dns.message.Message object @param where: where to send the message @type where: string containing an IPv4 or IPv6 address @param timeout: The number of seconds to wait before the query times out. If None, the default, wait forever. @type timeout: float @param port: The port to which to send the message. The default is 53. @type port: int @param af: the address family to use. The default is None, which causes the address family to use to be inferred from the form of where. If the inference attempt fails, AF_INET is used. @type af: int @rtype: dns.message.Message object @param source: source address. The default is the wildcard address. @type source: string @param source_port: The port from which to send the message. The default is 0. @type source_port: int @param one_rr_per_rrset: Put each RR into its own RRset @type one_rr_per_rrset: bool """ wire = q.to_wire() (af, destination, source) = _destination_and_source(af, where, port, source, source_port) s = socket_factory(af, socket.SOCK_STREAM, 0) begin_time = None try: expiration = _compute_expiration(timeout) s.setblocking(0) begin_time = time.time() if source is not None: s.bind(source) _connect(s, destination) l = len(wire) # copying the wire into tcpmsg is inefficient, but lets us # avoid writev() or doing a short write that would get pushed # onto the net tcpmsg = struct.pack("!H", l) + wire _net_write(s, tcpmsg, expiration) ldata = _net_read(s, 2, expiration) (l,) = struct.unpack("!H", ldata) wire = _net_read(s, l, expiration) finally: if begin_time is None: response_time = 0 else: response_time = time.time() - begin_time s.close() r = dns.message.from_wire(wire, keyring=q.keyring, request_mac=q.mac, one_rr_per_rrset=one_rr_per_rrset) r.time = response_time if not q.is_response(r): raise BadResponse return r def xfr(where, zone, rdtype=dns.rdatatype.AXFR, rdclass=dns.rdataclass.IN, timeout=None, port=53, keyring=None, keyname=None, relativize=True, af=None, lifetime=None, source=None, source_port=0, serial=0, use_udp=False, keyalgorithm=dns.tsig.default_algorithm): """Return a generator for the responses to a zone transfer. @param where: where to send the message @type where: string containing an IPv4 or IPv6 address @param zone: The name of the zone to transfer @type zone: dns.name.Name object or string @param rdtype: The type of zone transfer. The default is dns.rdatatype.AXFR. @type rdtype: int or string @param rdclass: The class of the zone transfer. The default is dns.rdataclass.IN. @type rdclass: int or string @param timeout: The number of seconds to wait for each response message. If None, the default, wait forever. @type timeout: float @param port: The port to which to send the message. The default is 53. @type port: int @param keyring: The TSIG keyring to use @type keyring: dict @param keyname: The name of the TSIG key to use @type keyname: dns.name.Name object or string @param relativize: If True, all names in the zone will be relativized to the zone origin. It is essential that the relativize setting matches the one specified to dns.zone.from_xfr(). @type relativize: bool @param af: the address family to use. The default is None, which causes the address family to use to be inferred from the form of where. If the inference attempt fails, AF_INET is used. @type af: int @param lifetime: The total number of seconds to spend doing the transfer. If None, the default, then there is no limit on the time the transfer may take. @type lifetime: float @rtype: generator of dns.message.Message objects. @param source: source address. The default is the wildcard address. @type source: string @param source_port: The port from which to send the message. The default is 0. @type source_port: int @param serial: The SOA serial number to use as the base for an IXFR diff sequence (only meaningful if rdtype == dns.rdatatype.IXFR). @type serial: int @param use_udp: Use UDP (only meaningful for IXFR) @type use_udp: bool @param keyalgorithm: The TSIG algorithm to use; defaults to dns.tsig.default_algorithm @type keyalgorithm: string """ if isinstance(zone, string_types): zone = dns.name.from_text(zone) if isinstance(rdtype, string_types): rdtype = dns.rdatatype.from_text(rdtype) q = dns.message.make_query(zone, rdtype, rdclass) if rdtype == dns.rdatatype.IXFR: rrset = dns.rrset.from_text(zone, 0, 'IN', 'SOA', '. . %u 0 0 0 0' % serial) q.authority.append(rrset) if keyring is not None: q.use_tsig(keyring, keyname, algorithm=keyalgorithm) wire = q.to_wire() (af, destination, source) = _destination_and_source(af, where, port, source, source_port) if use_udp: if rdtype != dns.rdatatype.IXFR: raise ValueError('cannot do a UDP AXFR') s = socket_factory(af, socket.SOCK_DGRAM, 0) else: s = socket_factory(af, socket.SOCK_STREAM, 0) s.setblocking(0) if source is not None: s.bind(source) expiration = _compute_expiration(lifetime) _connect(s, destination) l = len(wire) if use_udp: _wait_for_writable(s, expiration) s.send(wire) else: tcpmsg = struct.pack("!H", l) + wire _net_write(s, tcpmsg, expiration) done = False delete_mode = True expecting_SOA = False soa_rrset = None if relativize: origin = zone oname = dns.name.empty else: origin = None oname = zone tsig_ctx = None first = True while not done: mexpiration = _compute_expiration(timeout) if mexpiration is None or \ (expiration is not None and mexpiration > expiration): mexpiration = expiration if use_udp: _wait_for_readable(s, expiration) (wire, from_address) = s.recvfrom(65535) else: ldata = _net_read(s, 2, mexpiration) (l,) = struct.unpack("!H", ldata) wire = _net_read(s, l, mexpiration) is_ixfr = (rdtype == dns.rdatatype.IXFR) r = dns.message.from_wire(wire, keyring=q.keyring, request_mac=q.mac, xfr=True, origin=origin, tsig_ctx=tsig_ctx, multi=True, first=first, one_rr_per_rrset=is_ixfr) tsig_ctx = r.tsig_ctx first = False answer_index = 0 if soa_rrset is None: if not r.answer or r.answer[0].name != oname: raise dns.exception.FormError( "No answer or RRset not for qname") rrset = r.answer[0] if rrset.rdtype != dns.rdatatype.SOA: raise dns.exception.FormError("first RRset is not an SOA") answer_index = 1 soa_rrset = rrset.copy() if rdtype == dns.rdatatype.IXFR: if soa_rrset[0].serial <= serial: # # We're already up-to-date. # done = True else: expecting_SOA = True # # Process SOAs in the answer section (other than the initial # SOA in the first message). # for rrset in r.answer[answer_index:]: if done: raise dns.exception.FormError("answers after final SOA") if rrset.rdtype == dns.rdatatype.SOA and rrset.name == oname: if expecting_SOA: if rrset[0].serial != serial: raise dns.exception.FormError( "IXFR base serial mismatch") expecting_SOA = False elif rdtype == dns.rdatatype.IXFR: delete_mode = not delete_mode # # If this SOA RRset is equal to the first we saw then we're # finished. If this is an IXFR we also check that we're seeing # the record in the expected part of the response. # if rrset == soa_rrset and \ (rdtype == dns.rdatatype.AXFR or (rdtype == dns.rdatatype.IXFR and delete_mode)): done = True elif expecting_SOA: # # We made an IXFR request and are expecting another # SOA RR, but saw something else, so this must be an # AXFR response. # rdtype = dns.rdatatype.AXFR expecting_SOA = False if done and q.keyring and not r.had_tsig: raise dns.exception.FormError("missing TSIG") yield r s.close() PK g\k k rrset.pynu [ # Copyright (C) 2003-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. """DNS RRsets (an RRset is a named rdataset)""" import dns.name import dns.rdataset import dns.rdataclass import dns.renderer from ._compat import string_types class RRset(dns.rdataset.Rdataset): """A DNS RRset (named rdataset). RRset inherits from Rdataset, and RRsets can be treated as Rdatasets in most cases. There are, however, a few notable exceptions. RRsets have different to_wire() and to_text() method arguments, reflecting the fact that RRsets always have an owner name. """ __slots__ = ['name', 'deleting'] def __init__(self, name, rdclass, rdtype, covers=dns.rdatatype.NONE, deleting=None): """Create a new RRset.""" super(RRset, self).__init__(rdclass, rdtype, covers) self.name = name self.deleting = deleting def _clone(self): obj = super(RRset, self)._clone() obj.name = self.name obj.deleting = self.deleting return obj def __repr__(self): if self.covers == 0: ctext = '' else: ctext = '(' + dns.rdatatype.to_text(self.covers) + ')' if self.deleting is not None: dtext = ' delete=' + dns.rdataclass.to_text(self.deleting) else: dtext = '' return '<DNS ' + str(self.name) + ' ' + \ dns.rdataclass.to_text(self.rdclass) + ' ' + \ dns.rdatatype.to_text(self.rdtype) + ctext + dtext + ' RRset>' def __str__(self): return self.to_text() def __eq__(self, other): """Two RRsets are equal if they have the same name and the same rdataset @rtype: bool""" if not isinstance(other, RRset): return False if self.name != other.name: return False return super(RRset, self).__eq__(other) def match(self, name, rdclass, rdtype, covers, deleting=None): """Returns True if this rrset matches the specified class, type, covers, and deletion state.""" if not super(RRset, self).match(rdclass, rdtype, covers): return False if self.name != name or self.deleting != deleting: return False return True def to_text(self, origin=None, relativize=True, **kw): """Convert the RRset into DNS master file format. @see: L{dns.name.Name.choose_relativity} for more information on how I{origin} and I{relativize} determine the way names are emitted. Any additional keyword arguments are passed on to the rdata to_text() method. @param origin: The origin for relative names, or None. @type origin: dns.name.Name object @param relativize: True if names should names be relativized @type relativize: bool""" return super(RRset, self).to_text(self.name, origin, relativize, self.deleting, **kw) def to_wire(self, file, compress=None, origin=None, **kw): """Convert the RRset to wire format.""" return super(RRset, self).to_wire(self.name, file, compress, origin, self.deleting, **kw) def to_rdataset(self): """Convert an RRset into an Rdataset. @rtype: dns.rdataset.Rdataset object """ return dns.rdataset.from_rdata_list(self.ttl, list(self)) def from_text_list(name, ttl, rdclass, rdtype, text_rdatas, idna_codec=None): """Create an RRset with the specified name, TTL, class, and type, and with the specified list of rdatas in text format. @rtype: dns.rrset.RRset object """ if isinstance(name, string_types): name = dns.name.from_text(name, None, idna_codec=idna_codec) if isinstance(rdclass, string_types): rdclass = dns.rdataclass.from_text(rdclass) if isinstance(rdtype, string_types): rdtype = dns.rdatatype.from_text(rdtype) r = RRset(name, rdclass, rdtype) r.update_ttl(ttl) for t in text_rdatas: rd = dns.rdata.from_text(r.rdclass, r.rdtype, t) r.add(rd) return r def from_text(name, ttl, rdclass, rdtype, *text_rdatas): """Create an RRset with the specified name, TTL, class, and type and with the specified rdatas in text format. @rtype: dns.rrset.RRset object """ return from_text_list(name, ttl, rdclass, rdtype, text_rdatas) def from_rdata_list(name, ttl, rdatas, idna_codec=None): """Create an RRset with the specified name and TTL, and with the specified list of rdata objects. @rtype: dns.rrset.RRset object """ if isinstance(name, string_types): name = dns.name.from_text(name, None, idna_codec=idna_codec) if len(rdatas) == 0: raise ValueError("rdata list must not be empty") r = None for rd in rdatas: if r is None: r = RRset(name, rd.rdclass, rd.rdtype) r.update_ttl(ttl) r.add(rd) return r def from_rdata(name, ttl, *rdatas): """Create an RRset with the specified name and TTL, and with the specified rdata objects. @rtype: dns.rrset.RRset object """ return from_rdata_list(name, ttl, rdatas) PK g\D|Z Z zone.pynu [ # Copyright (C) 2003-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. """DNS Zones.""" from __future__ import generators import sys import re import os from io import BytesIO import dns.exception import dns.name import dns.node import dns.rdataclass import dns.rdatatype import dns.rdata import dns.rrset import dns.tokenizer import dns.ttl import dns.grange from ._compat import string_types, text_type _py3 = sys.version_info > (3,) class BadZone(dns.exception.DNSException): """The DNS zone is malformed.""" class NoSOA(BadZone): """The DNS zone has no SOA RR at its origin.""" class NoNS(BadZone): """The DNS zone has no NS RRset at its origin.""" class UnknownOrigin(BadZone): """The DNS zone's origin is unknown.""" class Zone(object): """A DNS zone. A Zone is a mapping from names to nodes. The zone object may be treated like a Python dictionary, e.g. zone[name] will retrieve the node associated with that name. The I{name} may be a dns.name.Name object, or it may be a string. In the either case, if the name is relative it is treated as relative to the origin of the zone. @ivar rdclass: The zone's rdata class; the default is class IN. @type rdclass: int @ivar origin: The origin of the zone. @type origin: dns.name.Name object @ivar nodes: A dictionary mapping the names of nodes in the zone to the nodes themselves. @type nodes: dict @ivar relativize: should names in the zone be relativized? @type relativize: bool @cvar node_factory: the factory used to create a new node @type node_factory: class or callable """ node_factory = dns.node.Node __slots__ = ['rdclass', 'origin', 'nodes', 'relativize'] def __init__(self, origin, rdclass=dns.rdataclass.IN, relativize=True): """Initialize a zone object. @param origin: The origin of the zone. @type origin: dns.name.Name object @param rdclass: The zone's rdata class; the default is class IN. @type rdclass: int""" if origin is not None: if isinstance(origin, string_types): origin = dns.name.from_text(origin) elif not isinstance(origin, dns.name.Name): raise ValueError("origin parameter must be convertible to a " "DNS name") if not origin.is_absolute(): raise ValueError("origin parameter must be an absolute name") self.origin = origin self.rdclass = rdclass self.nodes = {} self.relativize = relativize def __eq__(self, other): """Two zones are equal if they have the same origin, class, and nodes. @rtype: bool """ if not isinstance(other, Zone): return False if self.rdclass != other.rdclass or \ self.origin != other.origin or \ self.nodes != other.nodes: return False return True def __ne__(self, other): """Are two zones not equal? @rtype: bool """ return not self.__eq__(other) def _validate_name(self, name): if isinstance(name, string_types): name = dns.name.from_text(name, None) elif not isinstance(name, dns.name.Name): raise KeyError("name parameter must be convertible to a DNS name") if name.is_absolute(): if not name.is_subdomain(self.origin): raise KeyError( "name parameter must be a subdomain of the zone origin") if self.relativize: name = name.relativize(self.origin) return name def __getitem__(self, key): key = self._validate_name(key) return self.nodes[key] def __setitem__(self, key, value): key = self._validate_name(key) self.nodes[key] = value def __delitem__(self, key): key = self._validate_name(key) del self.nodes[key] def __iter__(self): return self.nodes.__iter__() def iterkeys(self): if _py3: return self.nodes.keys() else: return self.nodes.iterkeys() # pylint: disable=dict-iter-method def keys(self): return self.nodes.keys() def itervalues(self): if _py3: return self.nodes.values() else: return self.nodes.itervalues() # pylint: disable=dict-iter-method def values(self): return self.nodes.values() def items(self): return self.nodes.items() iteritems = items def get(self, key): key = self._validate_name(key) return self.nodes.get(key) def __contains__(self, other): return other in self.nodes def find_node(self, name, create=False): """Find a node in the zone, possibly creating it. @param name: the name of the node to find @type name: dns.name.Name object or string @param create: should the node be created if it doesn't exist? @type create: bool @raises KeyError: the name is not known and create was not specified. @rtype: dns.node.Node object """ name = self._validate_name(name) node = self.nodes.get(name) if node is None: if not create: raise KeyError node = self.node_factory() self.nodes[name] = node return node def get_node(self, name, create=False): """Get a node in the zone, possibly creating it. This method is like L{find_node}, except it returns None instead of raising an exception if the node does not exist and creation has not been requested. @param name: the name of the node to find @type name: dns.name.Name object or string @param create: should the node be created if it doesn't exist? @type create: bool @rtype: dns.node.Node object or None """ try: node = self.find_node(name, create) except KeyError: node = None return node def delete_node(self, name): """Delete the specified node if it exists. It is not an error if the node does not exist. """ name = self._validate_name(name) if name in self.nodes: del self.nodes[name] def find_rdataset(self, name, rdtype, covers=dns.rdatatype.NONE, create=False): """Look for rdata with the specified name and type in the zone, and return an rdataset encapsulating it. The I{name}, I{rdtype}, and I{covers} parameters may be strings, in which case they will be converted to their proper type. The rdataset returned is not a copy; changes to it will change the zone. KeyError is raised if the name or type are not found. Use L{get_rdataset} if you want to have None returned instead. @param name: the owner name to look for @type name: DNS.name.Name object or string @param rdtype: the rdata type desired @type rdtype: int or string @param covers: the covered type (defaults to None) @type covers: int or string @param create: should the node and rdataset be created if they do not exist? @type create: bool @raises KeyError: the node or rdata could not be found @rtype: dns.rrset.RRset object """ name = self._validate_name(name) if isinstance(rdtype, string_types): rdtype = dns.rdatatype.from_text(rdtype) if isinstance(covers, string_types): covers = dns.rdatatype.from_text(covers) node = self.find_node(name, create) return node.find_rdataset(self.rdclass, rdtype, covers, create) def get_rdataset(self, name, rdtype, covers=dns.rdatatype.NONE, create=False): """Look for rdata with the specified name and type in the zone, and return an rdataset encapsulating it. The I{name}, I{rdtype}, and I{covers} parameters may be strings, in which case they will be converted to their proper type. The rdataset returned is not a copy; changes to it will change the zone. None is returned if the name or type are not found. Use L{find_rdataset} if you want to have KeyError raised instead. @param name: the owner name to look for @type name: DNS.name.Name object or string @param rdtype: the rdata type desired @type rdtype: int or string @param covers: the covered type (defaults to None) @type covers: int or string @param create: should the node and rdataset be created if they do not exist? @type create: bool @rtype: dns.rrset.RRset object """ try: rdataset = self.find_rdataset(name, rdtype, covers, create) except KeyError: rdataset = None return rdataset def delete_rdataset(self, name, rdtype, covers=dns.rdatatype.NONE): """Delete the rdataset matching I{rdtype} and I{covers}, if it exists at the node specified by I{name}. The I{name}, I{rdtype}, and I{covers} parameters may be strings, in which case they will be converted to their proper type. It is not an error if the node does not exist, or if there is no matching rdataset at the node. If the node has no rdatasets after the deletion, it will itself be deleted. @param name: the owner name to look for @type name: DNS.name.Name object or string @param rdtype: the rdata type desired @type rdtype: int or string @param covers: the covered type (defaults to None) @type covers: int or string """ name = self._validate_name(name) if isinstance(rdtype, string_types): rdtype = dns.rdatatype.from_text(rdtype) if isinstance(covers, string_types): covers = dns.rdatatype.from_text(covers) node = self.get_node(name) if node is not None: node.delete_rdataset(self.rdclass, rdtype, covers) if len(node) == 0: self.delete_node(name) def replace_rdataset(self, name, replacement): """Replace an rdataset at name. It is not an error if there is no rdataset matching I{replacement}. Ownership of the I{replacement} object is transferred to the zone; in other words, this method does not store a copy of I{replacement} at the node, it stores I{replacement} itself. If the I{name} node does not exist, it is created. @param name: the owner name @type name: DNS.name.Name object or string @param replacement: the replacement rdataset @type replacement: dns.rdataset.Rdataset """ if replacement.rdclass != self.rdclass: raise ValueError('replacement.rdclass != zone.rdclass') node = self.find_node(name, True) node.replace_rdataset(replacement) def find_rrset(self, name, rdtype, covers=dns.rdatatype.NONE): """Look for rdata with the specified name and type in the zone, and return an RRset encapsulating it. The I{name}, I{rdtype}, and I{covers} parameters may be strings, in which case they will be converted to their proper type. This method is less efficient than the similar L{find_rdataset} because it creates an RRset instead of returning the matching rdataset. It may be more convenient for some uses since it returns an object which binds the owner name to the rdata. This method may not be used to create new nodes or rdatasets; use L{find_rdataset} instead. KeyError is raised if the name or type are not found. Use L{get_rrset} if you want to have None returned instead. @param name: the owner name to look for @type name: DNS.name.Name object or string @param rdtype: the rdata type desired @type rdtype: int or string @param covers: the covered type (defaults to None) @type covers: int or string @raises KeyError: the node or rdata could not be found @rtype: dns.rrset.RRset object """ name = self._validate_name(name) if isinstance(rdtype, string_types): rdtype = dns.rdatatype.from_text(rdtype) if isinstance(covers, string_types): covers = dns.rdatatype.from_text(covers) rdataset = self.nodes[name].find_rdataset(self.rdclass, rdtype, covers) rrset = dns.rrset.RRset(name, self.rdclass, rdtype, covers) rrset.update(rdataset) return rrset def get_rrset(self, name, rdtype, covers=dns.rdatatype.NONE): """Look for rdata with the specified name and type in the zone, and return an RRset encapsulating it. The I{name}, I{rdtype}, and I{covers} parameters may be strings, in which case they will be converted to their proper type. This method is less efficient than the similar L{get_rdataset} because it creates an RRset instead of returning the matching rdataset. It may be more convenient for some uses since it returns an object which binds the owner name to the rdata. This method may not be used to create new nodes or rdatasets; use L{find_rdataset} instead. None is returned if the name or type are not found. Use L{find_rrset} if you want to have KeyError raised instead. @param name: the owner name to look for @type name: DNS.name.Name object or string @param rdtype: the rdata type desired @type rdtype: int or string @param covers: the covered type (defaults to None) @type covers: int or string @rtype: dns.rrset.RRset object """ try: rrset = self.find_rrset(name, rdtype, covers) except KeyError: rrset = None return rrset def iterate_rdatasets(self, rdtype=dns.rdatatype.ANY, covers=dns.rdatatype.NONE): """Return a generator which yields (name, rdataset) tuples for all rdatasets in the zone which have the specified I{rdtype} and I{covers}. If I{rdtype} is dns.rdatatype.ANY, the default, then all rdatasets will be matched. @param rdtype: int or string @type rdtype: int or string @param covers: the covered type (defaults to None) @type covers: int or string """ if isinstance(rdtype, string_types): rdtype = dns.rdatatype.from_text(rdtype) if isinstance(covers, string_types): covers = dns.rdatatype.from_text(covers) for (name, node) in self.iteritems(): for rds in node: if rdtype == dns.rdatatype.ANY or \ (rds.rdtype == rdtype and rds.covers == covers): yield (name, rds) def iterate_rdatas(self, rdtype=dns.rdatatype.ANY, covers=dns.rdatatype.NONE): """Return a generator which yields (name, ttl, rdata) tuples for all rdatas in the zone which have the specified I{rdtype} and I{covers}. If I{rdtype} is dns.rdatatype.ANY, the default, then all rdatas will be matched. @param rdtype: int or string @type rdtype: int or string @param covers: the covered type (defaults to None) @type covers: int or string """ if isinstance(rdtype, string_types): rdtype = dns.rdatatype.from_text(rdtype) if isinstance(covers, string_types): covers = dns.rdatatype.from_text(covers) for (name, node) in self.iteritems(): for rds in node: if rdtype == dns.rdatatype.ANY or \ (rds.rdtype == rdtype and rds.covers == covers): for rdata in rds: yield (name, rds.ttl, rdata) def to_file(self, f, sorted=True, relativize=True, nl=None): """Write a zone to a file. @param f: file or string. If I{f} is a string, it is treated as the name of a file to open. @param sorted: if True, the file will be written with the names sorted in DNSSEC order from least to greatest. Otherwise the names will be written in whatever order they happen to have in the zone's dictionary. @param relativize: if True, domain names in the output will be relativized to the zone's origin (if possible). @type relativize: bool @param nl: The end of line string. If not specified, the output will use the platform's native end-of-line marker (i.e. LF on POSIX, CRLF on Windows, CR on Macintosh). @type nl: string or None """ if isinstance(f, string_types): f = open(f, 'wb') want_close = True else: want_close = False # must be in this way, f.encoding may contain None, or even attribute # may not be there file_enc = getattr(f, 'encoding', None) if file_enc is None: file_enc = 'utf-8' if nl is None: nl_b = os.linesep.encode(file_enc) # binary mode, '\n' is not enough nl = u'\n' elif isinstance(nl, string_types): nl_b = nl.encode(file_enc) else: nl_b = nl nl = nl.decode() try: if sorted: names = list(self.keys()) names.sort() else: names = self.iterkeys() for n in names: l = self[n].to_text(n, origin=self.origin, relativize=relativize) if isinstance(l, text_type): l_b = l.encode(file_enc) else: l_b = l l = l.decode() try: f.write(l_b) f.write(nl_b) except TypeError: # textual mode f.write(l) f.write(nl) finally: if want_close: f.close() def to_text(self, sorted=True, relativize=True, nl=None): """Return a zone's text as though it were written to a file. @param sorted: if True, the file will be written with the names sorted in DNSSEC order from least to greatest. Otherwise the names will be written in whatever order they happen to have in the zone's dictionary. @param relativize: if True, domain names in the output will be relativized to the zone's origin (if possible). @type relativize: bool @param nl: The end of line string. If not specified, the output will use the platform's native end-of-line marker (i.e. LF on POSIX, CRLF on Windows, CR on Macintosh). @type nl: string or None """ temp_buffer = BytesIO() self.to_file(temp_buffer, sorted, relativize, nl) return_value = temp_buffer.getvalue() temp_buffer.close() return return_value def check_origin(self): """Do some simple checking of the zone's origin. @raises dns.zone.NoSOA: there is no SOA RR @raises dns.zone.NoNS: there is no NS RRset @raises KeyError: there is no origin node """ if self.relativize: name = dns.name.empty else: name = self.origin if self.get_rdataset(name, dns.rdatatype.SOA) is None: raise NoSOA if self.get_rdataset(name, dns.rdatatype.NS) is None: raise NoNS class _MasterReader(object): """Read a DNS master file @ivar tok: The tokenizer @type tok: dns.tokenizer.Tokenizer object @ivar ttl: The default TTL @type ttl: int @ivar last_name: The last name read @type last_name: dns.name.Name object @ivar current_origin: The current origin @type current_origin: dns.name.Name object @ivar relativize: should names in the zone be relativized? @type relativize: bool @ivar zone: the zone @type zone: dns.zone.Zone object @ivar saved_state: saved reader state (used when processing $INCLUDE) @type saved_state: list of (tokenizer, current_origin, last_name, file) tuples. @ivar current_file: the file object of the $INCLUDed file being parsed (None if no $INCLUDE is active). @ivar allow_include: is $INCLUDE allowed? @type allow_include: bool @ivar check_origin: should sanity checks of the origin node be done? The default is True. @type check_origin: bool """ def __init__(self, tok, origin, rdclass, relativize, zone_factory=Zone, allow_include=False, check_origin=True): if isinstance(origin, string_types): origin = dns.name.from_text(origin) self.tok = tok self.current_origin = origin self.relativize = relativize self.ttl = 0 self.last_name = self.current_origin self.zone = zone_factory(origin, rdclass, relativize=relativize) self.saved_state = [] self.current_file = None self.allow_include = allow_include self.check_origin = check_origin def _eat_line(self): while 1: token = self.tok.get() if token.is_eol_or_eof(): break def _rr_line(self): """Process one line from a DNS master file.""" # Name if self.current_origin is None: raise UnknownOrigin token = self.tok.get(want_leading=True) if not token.is_whitespace(): self.last_name = dns.name.from_text( token.value, self.current_origin) else: token = self.tok.get() if token.is_eol_or_eof(): # treat leading WS followed by EOL/EOF as if they were EOL/EOF. return self.tok.unget(token) name = self.last_name if not name.is_subdomain(self.zone.origin): self._eat_line() return if self.relativize: name = name.relativize(self.zone.origin) token = self.tok.get() if not token.is_identifier(): raise dns.exception.SyntaxError # TTL try: ttl = dns.ttl.from_text(token.value) token = self.tok.get() if not token.is_identifier(): raise dns.exception.SyntaxError except dns.ttl.BadTTL: ttl = self.ttl # Class try: rdclass = dns.rdataclass.from_text(token.value) token = self.tok.get() if not token.is_identifier(): raise dns.exception.SyntaxError except dns.exception.SyntaxError: raise dns.exception.SyntaxError except Exception: rdclass = self.zone.rdclass if rdclass != self.zone.rdclass: raise dns.exception.SyntaxError("RR class is not zone's class") # Type try: rdtype = dns.rdatatype.from_text(token.value) except: raise dns.exception.SyntaxError( "unknown rdatatype '%s'" % token.value) n = self.zone.nodes.get(name) if n is None: n = self.zone.node_factory() self.zone.nodes[name] = n try: rd = dns.rdata.from_text(rdclass, rdtype, self.tok, self.current_origin, False) except dns.exception.SyntaxError: # Catch and reraise. (ty, va) = sys.exc_info()[:2] raise va except: # All exceptions that occur in the processing of rdata # are treated as syntax errors. This is not strictly # correct, but it is correct almost all of the time. # We convert them to syntax errors so that we can emit # helpful filename:line info. (ty, va) = sys.exc_info()[:2] raise dns.exception.SyntaxError( "caught exception %s: %s" % (str(ty), str(va))) rd.choose_relativity(self.zone.origin, self.relativize) covers = rd.covers() rds = n.find_rdataset(rdclass, rdtype, covers, True) rds.add(rd, ttl) def _parse_modify(self, side): # Here we catch everything in '{' '}' in a group so we can replace it # with ''. is_generate1 = re.compile("^.*\$({(\+|-?)(\d+),(\d+),(.)}).*$") is_generate2 = re.compile("^.*\$({(\+|-?)(\d+)}).*$") is_generate3 = re.compile("^.*\$({(\+|-?)(\d+),(\d+)}).*$") # Sometimes there are modifiers in the hostname. These come after # the dollar sign. They are in the form: ${offset[,width[,base]]}. # Make names g1 = is_generate1.match(side) if g1: mod, sign, offset, width, base = g1.groups() if sign == '': sign = '+' g2 = is_generate2.match(side) if g2: mod, sign, offset = g2.groups() if sign == '': sign = '+' width = 0 base = 'd' g3 = is_generate3.match(side) if g3: mod, sign, offset, width = g1.groups() if sign == '': sign = '+' width = g1.groups()[2] base = 'd' if not (g1 or g2 or g3): mod = '' sign = '+' offset = 0 width = 0 base = 'd' if base != 'd': raise NotImplementedError() return mod, sign, offset, width, base def _generate_line(self): # range lhs [ttl] [class] type rhs [ comment ] """Process one line containing the GENERATE statement from a DNS master file.""" if self.current_origin is None: raise UnknownOrigin token = self.tok.get() # Range (required) try: start, stop, step = dns.grange.from_text(token.value) token = self.tok.get() if not token.is_identifier(): raise dns.exception.SyntaxError except: raise dns.exception.SyntaxError # lhs (required) try: lhs = token.value token = self.tok.get() if not token.is_identifier(): raise dns.exception.SyntaxError except: raise dns.exception.SyntaxError # TTL try: ttl = dns.ttl.from_text(token.value) token = self.tok.get() if not token.is_identifier(): raise dns.exception.SyntaxError except dns.ttl.BadTTL: ttl = self.ttl # Class try: rdclass = dns.rdataclass.from_text(token.value) token = self.tok.get() if not token.is_identifier(): raise dns.exception.SyntaxError except dns.exception.SyntaxError: raise dns.exception.SyntaxError except Exception: rdclass = self.zone.rdclass if rdclass != self.zone.rdclass: raise dns.exception.SyntaxError("RR class is not zone's class") # Type try: rdtype = dns.rdatatype.from_text(token.value) token = self.tok.get() if not token.is_identifier(): raise dns.exception.SyntaxError except Exception: raise dns.exception.SyntaxError("unknown rdatatype '%s'" % token.value) # lhs (required) try: rhs = token.value except: raise dns.exception.SyntaxError lmod, lsign, loffset, lwidth, lbase = self._parse_modify(lhs) rmod, rsign, roffset, rwidth, rbase = self._parse_modify(rhs) for i in range(start, stop + 1, step): # +1 because bind is inclusive and python is exclusive if lsign == u'+': lindex = i + int(loffset) elif lsign == u'-': lindex = i - int(loffset) if rsign == u'-': rindex = i - int(roffset) elif rsign == u'+': rindex = i + int(roffset) lzfindex = str(lindex).zfill(int(lwidth)) rzfindex = str(rindex).zfill(int(rwidth)) name = lhs.replace(u'$%s' % (lmod), lzfindex) rdata = rhs.replace(u'$%s' % (rmod), rzfindex) self.last_name = dns.name.from_text(name, self.current_origin) name = self.last_name if not name.is_subdomain(self.zone.origin): self._eat_line() return if self.relativize: name = name.relativize(self.zone.origin) n = self.zone.nodes.get(name) if n is None: n = self.zone.node_factory() self.zone.nodes[name] = n try: rd = dns.rdata.from_text(rdclass, rdtype, rdata, self.current_origin, False) except dns.exception.SyntaxError: # Catch and reraise. (ty, va) = sys.exc_info()[:2] raise va except: # All exceptions that occur in the processing of rdata # are treated as syntax errors. This is not strictly # correct, but it is correct almost all of the time. # We convert them to syntax errors so that we can emit # helpful filename:line info. (ty, va) = sys.exc_info()[:2] raise dns.exception.SyntaxError("caught exception %s: %s" % (str(ty), str(va))) rd.choose_relativity(self.zone.origin, self.relativize) covers = rd.covers() rds = n.find_rdataset(rdclass, rdtype, covers, True) rds.add(rd, ttl) def read(self): """Read a DNS master file and build a zone object. @raises dns.zone.NoSOA: No SOA RR was found at the zone origin @raises dns.zone.NoNS: No NS RRset was found at the zone origin """ try: while 1: token = self.tok.get(True, True) if token.is_eof(): if self.current_file is not None: self.current_file.close() if len(self.saved_state) > 0: (self.tok, self.current_origin, self.last_name, self.current_file, self.ttl) = self.saved_state.pop(-1) continue break elif token.is_eol(): continue elif token.is_comment(): self.tok.get_eol() continue elif token.value[0] == u'$': c = token.value.upper() if c == u'$TTL': token = self.tok.get() if not token.is_identifier(): raise dns.exception.SyntaxError("bad $TTL") self.ttl = dns.ttl.from_text(token.value) self.tok.get_eol() elif c == u'$ORIGIN': self.current_origin = self.tok.get_name() self.tok.get_eol() if self.zone.origin is None: self.zone.origin = self.current_origin elif c == u'$INCLUDE' and self.allow_include: token = self.tok.get() filename = token.value token = self.tok.get() if token.is_identifier(): new_origin =\ dns.name.from_text(token.value, self.current_origin) self.tok.get_eol() elif not token.is_eol_or_eof(): raise dns.exception.SyntaxError( "bad origin in $INCLUDE") else: new_origin = self.current_origin self.saved_state.append((self.tok, self.current_origin, self.last_name, self.current_file, self.ttl)) self.current_file = open(filename, 'r') self.tok = dns.tokenizer.Tokenizer(self.current_file, filename) self.current_origin = new_origin elif c == u'$GENERATE': self._generate_line() else: raise dns.exception.SyntaxError( "Unknown master file directive '" + c + "'") continue self.tok.unget(token) self._rr_line() except dns.exception.SyntaxError as detail: (filename, line_number) = self.tok.where() if detail is None: detail = "syntax error" raise dns.exception.SyntaxError( "%s:%d: %s" % (filename, line_number, detail)) # Now that we're done reading, do some basic checking of the zone. if self.check_origin: self.zone.check_origin() def from_text(text, origin=None, rdclass=dns.rdataclass.IN, relativize=True, zone_factory=Zone, filename=None, allow_include=False, check_origin=True): """Build a zone object from a master file format string. @param text: the master file format input @type text: string. @param origin: The origin of the zone; if not specified, the first $ORIGIN statement in the master file will determine the origin of the zone. @type origin: dns.name.Name object or string @param rdclass: The zone's rdata class; the default is class IN. @type rdclass: int @param relativize: should names be relativized? The default is True @type relativize: bool @param zone_factory: The zone factory to use @type zone_factory: function returning a Zone @param filename: The filename to emit when describing where an error occurred; the default is '<string>'. @type filename: string @param allow_include: is $INCLUDE allowed? @type allow_include: bool @param check_origin: should sanity checks of the origin node be done? The default is True. @type check_origin: bool @raises dns.zone.NoSOA: No SOA RR was found at the zone origin @raises dns.zone.NoNS: No NS RRset was found at the zone origin @rtype: dns.zone.Zone object """ # 'text' can also be a file, but we don't publish that fact # since it's an implementation detail. The official file # interface is from_file(). if filename is None: filename = '<string>' tok = dns.tokenizer.Tokenizer(text, filename) reader = _MasterReader(tok, origin, rdclass, relativize, zone_factory, allow_include=allow_include, check_origin=check_origin) reader.read() return reader.zone def from_file(f, origin=None, rdclass=dns.rdataclass.IN, relativize=True, zone_factory=Zone, filename=None, allow_include=True, check_origin=True): """Read a master file and build a zone object. @param f: file or string. If I{f} is a string, it is treated as the name of a file to open. @param origin: The origin of the zone; if not specified, the first $ORIGIN statement in the master file will determine the origin of the zone. @type origin: dns.name.Name object or string @param rdclass: The zone's rdata class; the default is class IN. @type rdclass: int @param relativize: should names be relativized? The default is True @type relativize: bool @param zone_factory: The zone factory to use @type zone_factory: function returning a Zone @param filename: The filename to emit when describing where an error occurred; the default is '<file>', or the value of I{f} if I{f} is a string. @type filename: string @param allow_include: is $INCLUDE allowed? @type allow_include: bool @param check_origin: should sanity checks of the origin node be done? The default is True. @type check_origin: bool @raises dns.zone.NoSOA: No SOA RR was found at the zone origin @raises dns.zone.NoNS: No NS RRset was found at the zone origin @rtype: dns.zone.Zone object """ str_type = string_types opts = 'rU' if isinstance(f, str_type): if filename is None: filename = f f = open(f, opts) want_close = True else: if filename is None: filename = '<file>' want_close = False try: z = from_text(f, origin, rdclass, relativize, zone_factory, filename, allow_include, check_origin) finally: if want_close: f.close() return z def from_xfr(xfr, zone_factory=Zone, relativize=True, check_origin=True): """Convert the output of a zone transfer generator into a zone object. @param xfr: The xfr generator @type xfr: generator of dns.message.Message objects @param relativize: should names be relativized? The default is True. It is essential that the relativize setting matches the one specified to dns.query.xfr(). @type relativize: bool @param check_origin: should sanity checks of the origin node be done? The default is True. @type check_origin: bool @raises dns.zone.NoSOA: No SOA RR was found at the zone origin @raises dns.zone.NoNS: No NS RRset was found at the zone origin @rtype: dns.zone.Zone object """ z = None for r in xfr: if z is None: if relativize: origin = r.origin else: origin = r.answer[0].name rdclass = r.answer[0].rdclass z = zone_factory(origin, rdclass, relativize=relativize) for rrset in r.answer: znode = z.nodes.get(rrset.name) if not znode: znode = z.node_factory() z.nodes[rrset.name] = znode zrds = znode.find_rdataset(rrset.rdclass, rrset.rdtype, rrset.covers, True) zrds.update_ttl(rrset.ttl) for rd in rrset: rd.choose_relativity(z.origin, relativize) zrds.add(rd) if check_origin: z.check_origin() return z PK g\3 rcode.pynu [ # Copyright (C) 2001-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. """DNS Result Codes.""" import dns.exception from ._compat import long NOERROR = 0 FORMERR = 1 SERVFAIL = 2 NXDOMAIN = 3 NOTIMP = 4 REFUSED = 5 YXDOMAIN = 6 YXRRSET = 7 NXRRSET = 8 NOTAUTH = 9 NOTZONE = 10 BADVERS = 16 _by_text = { 'NOERROR': NOERROR, 'FORMERR': FORMERR, 'SERVFAIL': SERVFAIL, 'NXDOMAIN': NXDOMAIN, 'NOTIMP': NOTIMP, 'REFUSED': REFUSED, 'YXDOMAIN': YXDOMAIN, 'YXRRSET': YXRRSET, 'NXRRSET': NXRRSET, 'NOTAUTH': NOTAUTH, 'NOTZONE': NOTZONE, 'BADVERS': BADVERS } # We construct the inverse mapping programmatically to ensure that we # cannot make any mistakes (e.g. omissions, cut-and-paste errors) that # would cause the mapping not to be a true inverse. _by_value = dict((y, x) for x, y in _by_text.items()) class UnknownRcode(dns.exception.DNSException): """A DNS rcode is unknown.""" def from_text(text): """Convert text into an rcode. @param text: the textual rcode @type text: string @raises UnknownRcode: the rcode is unknown @rtype: int """ if text.isdigit(): v = int(text) if v >= 0 and v <= 4095: return v v = _by_text.get(text.upper()) if v is None: raise UnknownRcode return v def from_flags(flags, ednsflags): """Return the rcode value encoded by flags and ednsflags. @param flags: the DNS flags @type flags: int @param ednsflags: the EDNS flags @type ednsflags: int @raises ValueError: rcode is < 0 or > 4095 @rtype: int """ value = (flags & 0x000f) | ((ednsflags >> 20) & 0xff0) if value < 0 or value > 4095: raise ValueError('rcode must be >= 0 and <= 4095') return value def to_flags(value): """Return a (flags, ednsflags) tuple which encodes the rcode. @param value: the rcode @type value: int @raises ValueError: rcode is < 0 or > 4095 @rtype: (int, int) tuple """ if value < 0 or value > 4095: raise ValueError('rcode must be >= 0 and <= 4095') v = value & 0xf ev = long(value & 0xff0) << 20 return (v, ev) def to_text(value): """Convert rcode into text. @param value: the rcode @type value: int @rtype: string """ text = _by_value.get(value) if text is None: text = str(value) return text PK g\$- $- rdataset.pynu [ # Copyright (C) 2001-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. """DNS rdatasets (an rdataset is a set of rdatas of a given type and class)""" import random from io import StringIO import struct import dns.exception import dns.rdatatype import dns.rdataclass import dns.rdata import dns.set from ._compat import string_types # define SimpleSet here for backwards compatibility SimpleSet = dns.set.Set class DifferingCovers(dns.exception.DNSException): """An attempt was made to add a DNS SIG/RRSIG whose covered type is not the same as that of the other rdatas in the rdataset.""" class IncompatibleTypes(dns.exception.DNSException): """An attempt was made to add DNS RR data of an incompatible type.""" class Rdataset(dns.set.Set): """A DNS rdataset. @ivar rdclass: The class of the rdataset @type rdclass: int @ivar rdtype: The type of the rdataset @type rdtype: int @ivar covers: The covered type. Usually this value is dns.rdatatype.NONE, but if the rdtype is dns.rdatatype.SIG or dns.rdatatype.RRSIG, then the covers value will be the rdata type the SIG/RRSIG covers. The library treats the SIG and RRSIG types as if they were a family of types, e.g. RRSIG(A), RRSIG(NS), RRSIG(SOA). This makes RRSIGs much easier to work with than if RRSIGs covering different rdata types were aggregated into a single RRSIG rdataset. @type covers: int @ivar ttl: The DNS TTL (Time To Live) value @type ttl: int """ __slots__ = ['rdclass', 'rdtype', 'covers', 'ttl'] def __init__(self, rdclass, rdtype, covers=dns.rdatatype.NONE): """Create a new rdataset of the specified class and type. @see: the description of the class instance variables for the meaning of I{rdclass} and I{rdtype}""" super(Rdataset, self).__init__() self.rdclass = rdclass self.rdtype = rdtype self.covers = covers self.ttl = 0 def _clone(self): obj = super(Rdataset, self)._clone() obj.rdclass = self.rdclass obj.rdtype = self.rdtype obj.covers = self.covers obj.ttl = self.ttl return obj def update_ttl(self, ttl): """Set the TTL of the rdataset to be the lesser of the set's current TTL or the specified TTL. If the set contains no rdatas, set the TTL to the specified TTL. @param ttl: The TTL @type ttl: int""" if len(self) == 0: self.ttl = ttl elif ttl < self.ttl: self.ttl = ttl def add(self, rd, ttl=None): """Add the specified rdata to the rdataset. If the optional I{ttl} parameter is supplied, then self.update_ttl(ttl) will be called prior to adding the rdata. @param rd: The rdata @type rd: dns.rdata.Rdata object @param ttl: The TTL @type ttl: int""" # # If we're adding a signature, do some special handling to # check that the signature covers the same type as the # other rdatas in this rdataset. If this is the first rdata # in the set, initialize the covers field. # if self.rdclass != rd.rdclass or self.rdtype != rd.rdtype: raise IncompatibleTypes if ttl is not None: self.update_ttl(ttl) if self.rdtype == dns.rdatatype.RRSIG or \ self.rdtype == dns.rdatatype.SIG: covers = rd.covers() if len(self) == 0 and self.covers == dns.rdatatype.NONE: self.covers = covers elif self.covers != covers: raise DifferingCovers if dns.rdatatype.is_singleton(rd.rdtype) and len(self) > 0: self.clear() super(Rdataset, self).add(rd) def union_update(self, other): self.update_ttl(other.ttl) super(Rdataset, self).union_update(other) def intersection_update(self, other): self.update_ttl(other.ttl) super(Rdataset, self).intersection_update(other) def update(self, other): """Add all rdatas in other to self. @param other: The rdataset from which to update @type other: dns.rdataset.Rdataset object""" self.update_ttl(other.ttl) super(Rdataset, self).update(other) def __repr__(self): if self.covers == 0: ctext = '' else: ctext = '(' + dns.rdatatype.to_text(self.covers) + ')' return '<DNS ' + dns.rdataclass.to_text(self.rdclass) + ' ' + \ dns.rdatatype.to_text(self.rdtype) + ctext + ' rdataset>' def __str__(self): return self.to_text() def __eq__(self, other): """Two rdatasets are equal if they have the same class, type, and covers, and contain the same rdata. @rtype: bool""" if not isinstance(other, Rdataset): return False if self.rdclass != other.rdclass or \ self.rdtype != other.rdtype or \ self.covers != other.covers: return False return super(Rdataset, self).__eq__(other) def __ne__(self, other): return not self.__eq__(other) def to_text(self, name=None, origin=None, relativize=True, override_rdclass=None, **kw): """Convert the rdataset into DNS master file format. @see: L{dns.name.Name.choose_relativity} for more information on how I{origin} and I{relativize} determine the way names are emitted. Any additional keyword arguments are passed on to the rdata to_text() method. @param name: If name is not None, emit a RRs with I{name} as the owner name. @type name: dns.name.Name object @param origin: The origin for relative names, or None. @type origin: dns.name.Name object @param relativize: True if names should names be relativized @type relativize: bool""" if name is not None: name = name.choose_relativity(origin, relativize) ntext = str(name) pad = ' ' else: ntext = '' pad = '' s = StringIO() if override_rdclass is not None: rdclass = override_rdclass else: rdclass = self.rdclass if len(self) == 0: # # Empty rdatasets are used for the question section, and in # some dynamic updates, so we don't need to print out the TTL # (which is meaningless anyway). # s.write(u'%s%s%s %s\n' % (ntext, pad, dns.rdataclass.to_text(rdclass), dns.rdatatype.to_text(self.rdtype))) else: for rd in self: s.write(u'%s%s%d %s %s %s\n' % (ntext, pad, self.ttl, dns.rdataclass.to_text(rdclass), dns.rdatatype.to_text(self.rdtype), rd.to_text(origin=origin, relativize=relativize, **kw))) # # We strip off the final \n for the caller's convenience in printing # return s.getvalue()[:-1] def to_wire(self, name, file, compress=None, origin=None, override_rdclass=None, want_shuffle=True): """Convert the rdataset to wire format. @param name: The owner name of the RRset that will be emitted @type name: dns.name.Name object @param file: The file to which the wire format data will be appended @type file: file @param compress: The compression table to use; the default is None. @type compress: dict @param origin: The origin to be appended to any relative names when they are emitted. The default is None. @returns: the number of records emitted @rtype: int """ if override_rdclass is not None: rdclass = override_rdclass want_shuffle = False else: rdclass = self.rdclass file.seek(0, 2) if len(self) == 0: name.to_wire(file, compress, origin) stuff = struct.pack("!HHIH", self.rdtype, rdclass, 0, 0) file.write(stuff) return 1 else: if want_shuffle: l = list(self) random.shuffle(l) else: l = self for rd in l: name.to_wire(file, compress, origin) stuff = struct.pack("!HHIH", self.rdtype, rdclass, self.ttl, 0) file.write(stuff) start = file.tell() rd.to_wire(file, compress, origin) end = file.tell() assert end - start < 65536 file.seek(start - 2) stuff = struct.pack("!H", end - start) file.write(stuff) file.seek(0, 2) return len(self) def match(self, rdclass, rdtype, covers): """Returns True if this rdataset matches the specified class, type, and covers""" if self.rdclass == rdclass and \ self.rdtype == rdtype and \ self.covers == covers: return True return False def from_text_list(rdclass, rdtype, ttl, text_rdatas): """Create an rdataset with the specified class, type, and TTL, and with the specified list of rdatas in text format. @rtype: dns.rdataset.Rdataset object """ if isinstance(rdclass, string_types): rdclass = dns.rdataclass.from_text(rdclass) if isinstance(rdtype, string_types): rdtype = dns.rdatatype.from_text(rdtype) r = Rdataset(rdclass, rdtype) r.update_ttl(ttl) for t in text_rdatas: rd = dns.rdata.from_text(r.rdclass, r.rdtype, t) r.add(rd) return r def from_text(rdclass, rdtype, ttl, *text_rdatas): """Create an rdataset with the specified class, type, and TTL, and with the specified rdatas in text format. @rtype: dns.rdataset.Rdataset object """ return from_text_list(rdclass, rdtype, ttl, text_rdatas) def from_rdata_list(ttl, rdatas): """Create an rdataset with the specified TTL, and with the specified list of rdata objects. @rtype: dns.rdataset.Rdataset object """ if len(rdatas) == 0: raise ValueError("rdata list must not be empty") r = None for rd in rdatas: if r is None: r = Rdataset(rd.rdclass, rd.rdtype) r.update_ttl(ttl) r.add(rd) return r def from_rdata(ttl, *rdatas): """Create an rdataset with the specified TTL, and with the specified rdata objects. @rtype: dns.rdataset.Rdataset object """ return from_rdata_list(ttl, rdatas) PK g\ĵK K e164.pynu [ # Copyright (C) 2006, 2007, 2009, 2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. """DNS E.164 helpers @var public_enum_domain: The DNS public ENUM domain, e164.arpa. @type public_enum_domain: dns.name.Name object """ import dns.exception import dns.name import dns.resolver from ._compat import string_types public_enum_domain = dns.name.from_text('e164.arpa.') def from_e164(text, origin=public_enum_domain): """Convert an E.164 number in textual form into a Name object whose value is the ENUM domain name for that number. @param text: an E.164 number in textual form. @type text: str @param origin: The domain in which the number should be constructed. The default is e164.arpa. @type origin: dns.name.Name object or None @rtype: dns.name.Name object """ parts = [d for d in text if d.isdigit()] parts.reverse() return dns.name.from_text('.'.join(parts), origin=origin) def to_e164(name, origin=public_enum_domain, want_plus_prefix=True): """Convert an ENUM domain name into an E.164 number. @param name: the ENUM domain name. @type name: dns.name.Name object. @param origin: A domain containing the ENUM domain name. The name is relativized to this domain before being converted to text. @type origin: dns.name.Name object or None @param want_plus_prefix: if True, add a '+' to the beginning of the returned number. @rtype: str """ if origin is not None: name = name.relativize(origin) dlabels = [d for d in name.labels if d.isdigit() and len(d) == 1] if len(dlabels) != len(name.labels): raise dns.exception.SyntaxError('non-digit labels in ENUM domain name') dlabels.reverse() text = b''.join(dlabels) if want_plus_prefix: text = b'+' + text return text def query(number, domains, resolver=None): """Look for NAPTR RRs for the specified number in the specified domains. e.g. lookup('16505551212', ['e164.dnspython.org.', 'e164.arpa.']) """ if resolver is None: resolver = dns.resolver.get_default_resolver() e_nx = dns.resolver.NXDOMAIN() for domain in domains: if isinstance(domain, string_types): domain = dns.name.from_text(domain) qname = dns.e164.from_e164(number, domain) try: return resolver.query(qname, 'NAPTR') except dns.resolver.NXDOMAIN as e: e_nx += e raise e_nx PK g\D9 9 dnssec.pynu [ # Copyright (C) 2003-2007, 2009, 2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. """Common DNSSEC-related functions and constants.""" from io import BytesIO import struct import time import dns.exception import dns.hash import dns.name import dns.node import dns.rdataset import dns.rdata import dns.rdatatype import dns.rdataclass from ._compat import string_types class UnsupportedAlgorithm(dns.exception.DNSException): """The DNSSEC algorithm is not supported.""" class ValidationFailure(dns.exception.DNSException): """The DNSSEC signature is invalid.""" RSAMD5 = 1 DH = 2 DSA = 3 ECC = 4 RSASHA1 = 5 DSANSEC3SHA1 = 6 RSASHA1NSEC3SHA1 = 7 RSASHA256 = 8 RSASHA512 = 10 ECDSAP256SHA256 = 13 ECDSAP384SHA384 = 14 INDIRECT = 252 PRIVATEDNS = 253 PRIVATEOID = 254 _algorithm_by_text = { 'RSAMD5': RSAMD5, 'DH': DH, 'DSA': DSA, 'ECC': ECC, 'RSASHA1': RSASHA1, 'DSANSEC3SHA1': DSANSEC3SHA1, 'RSASHA1NSEC3SHA1': RSASHA1NSEC3SHA1, 'RSASHA256': RSASHA256, 'RSASHA512': RSASHA512, 'INDIRECT': INDIRECT, 'ECDSAP256SHA256': ECDSAP256SHA256, 'ECDSAP384SHA384': ECDSAP384SHA384, 'PRIVATEDNS': PRIVATEDNS, 'PRIVATEOID': PRIVATEOID, } # We construct the inverse mapping programmatically to ensure that we # cannot make any mistakes (e.g. omissions, cut-and-paste errors) that # would cause the mapping not to be true inverse. _algorithm_by_value = dict((y, x) for x, y in _algorithm_by_text.items()) def algorithm_from_text(text): """Convert text into a DNSSEC algorithm value @rtype: int""" value = _algorithm_by_text.get(text.upper()) if value is None: value = int(text) return value def algorithm_to_text(value): """Convert a DNSSEC algorithm value to text @rtype: string""" text = _algorithm_by_value.get(value) if text is None: text = str(value) return text def _to_rdata(record, origin): s = BytesIO() record.to_wire(s, origin=origin) return s.getvalue() def key_id(key, origin=None): rdata = _to_rdata(key, origin) rdata = bytearray(rdata) if key.algorithm == RSAMD5: return (rdata[-3] << 8) + rdata[-2] else: total = 0 for i in range(len(rdata) // 2): total += (rdata[2 * i] << 8) + \ rdata[2 * i + 1] if len(rdata) % 2 != 0: total += rdata[len(rdata) - 1] << 8 total += ((total >> 16) & 0xffff) return total & 0xffff def make_ds(name, key, algorithm, origin=None): if algorithm.upper() == 'SHA1': dsalg = 1 hash = dns.hash.hashes['SHA1']() elif algorithm.upper() == 'SHA256': dsalg = 2 hash = dns.hash.hashes['SHA256']() else: raise UnsupportedAlgorithm('unsupported algorithm "%s"' % algorithm) if isinstance(name, string_types): name = dns.name.from_text(name, origin) hash.update(name.canonicalize().to_wire()) hash.update(_to_rdata(key, origin)) digest = hash.digest() dsrdata = struct.pack("!HBB", key_id(key), key.algorithm, dsalg) + digest return dns.rdata.from_wire(dns.rdataclass.IN, dns.rdatatype.DS, dsrdata, 0, len(dsrdata)) def _find_candidate_keys(keys, rrsig): candidate_keys = [] value = keys.get(rrsig.signer) if value is None: return None if isinstance(value, dns.node.Node): try: rdataset = value.find_rdataset(dns.rdataclass.IN, dns.rdatatype.DNSKEY) except KeyError: return None else: rdataset = value for rdata in rdataset: if rdata.algorithm == rrsig.algorithm and \ key_id(rdata) == rrsig.key_tag: candidate_keys.append(rdata) return candidate_keys def _is_rsa(algorithm): return algorithm in (RSAMD5, RSASHA1, RSASHA1NSEC3SHA1, RSASHA256, RSASHA512) def _is_dsa(algorithm): return algorithm in (DSA, DSANSEC3SHA1) def _is_ecdsa(algorithm): return _have_ecdsa and (algorithm in (ECDSAP256SHA256, ECDSAP384SHA384)) def _is_md5(algorithm): return algorithm == RSAMD5 def _is_sha1(algorithm): return algorithm in (DSA, RSASHA1, DSANSEC3SHA1, RSASHA1NSEC3SHA1) def _is_sha256(algorithm): return algorithm in (RSASHA256, ECDSAP256SHA256) def _is_sha384(algorithm): return algorithm == ECDSAP384SHA384 def _is_sha512(algorithm): return algorithm == RSASHA512 def _make_hash(algorithm): if _is_md5(algorithm): return dns.hash.hashes['MD5']() if _is_sha1(algorithm): return dns.hash.hashes['SHA1']() if _is_sha256(algorithm): return dns.hash.hashes['SHA256']() if _is_sha384(algorithm): return dns.hash.hashes['SHA384']() if _is_sha512(algorithm): return dns.hash.hashes['SHA512']() raise ValidationFailure('unknown hash for algorithm %u' % algorithm) def _make_algorithm_id(algorithm): if _is_md5(algorithm): oid = [0x2a, 0x86, 0x48, 0x86, 0xf7, 0x0d, 0x02, 0x05] elif _is_sha1(algorithm): oid = [0x2b, 0x0e, 0x03, 0x02, 0x1a] elif _is_sha256(algorithm): oid = [0x60, 0x86, 0x48, 0x01, 0x65, 0x03, 0x04, 0x02, 0x01] elif _is_sha512(algorithm): oid = [0x60, 0x86, 0x48, 0x01, 0x65, 0x03, 0x04, 0x02, 0x03] else: raise ValidationFailure('unknown algorithm %u' % algorithm) olen = len(oid) dlen = _make_hash(algorithm).digest_size idbytes = [0x30] + [8 + olen + dlen] + \ [0x30, olen + 4] + [0x06, olen] + oid + \ [0x05, 0x00] + [0x04, dlen] return struct.pack('!%dB' % len(idbytes), *idbytes) def _validate_rrsig(rrset, rrsig, keys, origin=None, now=None): """Validate an RRset against a single signature rdata The owner name of the rrsig is assumed to be the same as the owner name of the rrset. @param rrset: The RRset to validate @type rrset: dns.rrset.RRset or (dns.name.Name, dns.rdataset.Rdataset) tuple @param rrsig: The signature rdata @type rrsig: dns.rrset.Rdata @param keys: The key dictionary. @type keys: a dictionary keyed by dns.name.Name with node or rdataset values @param origin: The origin to use for relative names @type origin: dns.name.Name or None @param now: The time to use when validating the signatures. The default is the current time. @type now: int """ if isinstance(origin, string_types): origin = dns.name.from_text(origin, dns.name.root) for candidate_key in _find_candidate_keys(keys, rrsig): if not candidate_key: raise ValidationFailure('unknown key') # For convenience, allow the rrset to be specified as a (name, # rdataset) tuple as well as a proper rrset if isinstance(rrset, tuple): rrname = rrset[0] rdataset = rrset[1] else: rrname = rrset.name rdataset = rrset if now is None: now = time.time() if rrsig.expiration < now: raise ValidationFailure('expired') if rrsig.inception > now: raise ValidationFailure('not yet valid') hash = _make_hash(rrsig.algorithm) if _is_rsa(rrsig.algorithm): keyptr = candidate_key.key (bytes_,) = struct.unpack('!B', keyptr[0:1]) keyptr = keyptr[1:] if bytes_ == 0: (bytes_,) = struct.unpack('!H', keyptr[0:2]) keyptr = keyptr[2:] rsa_e = keyptr[0:bytes_] rsa_n = keyptr[bytes_:] keylen = len(rsa_n) * 8 pubkey = Crypto.PublicKey.RSA.construct( (Crypto.Util.number.bytes_to_long(rsa_n), Crypto.Util.number.bytes_to_long(rsa_e))) sig = (Crypto.Util.number.bytes_to_long(rrsig.signature),) elif _is_dsa(rrsig.algorithm): keyptr = candidate_key.key (t,) = struct.unpack('!B', keyptr[0:1]) keyptr = keyptr[1:] octets = 64 + t * 8 dsa_q = keyptr[0:20] keyptr = keyptr[20:] dsa_p = keyptr[0:octets] keyptr = keyptr[octets:] dsa_g = keyptr[0:octets] keyptr = keyptr[octets:] dsa_y = keyptr[0:octets] pubkey = Crypto.PublicKey.DSA.construct( (Crypto.Util.number.bytes_to_long(dsa_y), Crypto.Util.number.bytes_to_long(dsa_g), Crypto.Util.number.bytes_to_long(dsa_p), Crypto.Util.number.bytes_to_long(dsa_q))) (dsa_r, dsa_s) = struct.unpack('!20s20s', rrsig.signature[1:]) sig = (Crypto.Util.number.bytes_to_long(dsa_r), Crypto.Util.number.bytes_to_long(dsa_s)) elif _is_ecdsa(rrsig.algorithm): if rrsig.algorithm == ECDSAP256SHA256: curve = ecdsa.curves.NIST256p key_len = 32 elif rrsig.algorithm == ECDSAP384SHA384: curve = ecdsa.curves.NIST384p key_len = 48 else: # shouldn't happen raise ValidationFailure('unknown ECDSA curve') keyptr = candidate_key.key x = Crypto.Util.number.bytes_to_long(keyptr[0:key_len]) y = Crypto.Util.number.bytes_to_long(keyptr[key_len:key_len * 2]) assert ecdsa.ecdsa.point_is_valid(curve.generator, x, y) point = ecdsa.ellipticcurve.Point(curve.curve, x, y, curve.order) verifying_key = ecdsa.keys.VerifyingKey.from_public_point(point, curve) pubkey = ECKeyWrapper(verifying_key, key_len) r = rrsig.signature[:key_len] s = rrsig.signature[key_len:] sig = ecdsa.ecdsa.Signature(Crypto.Util.number.bytes_to_long(r), Crypto.Util.number.bytes_to_long(s)) else: raise ValidationFailure('unknown algorithm %u' % rrsig.algorithm) hash.update(_to_rdata(rrsig, origin)[:18]) hash.update(rrsig.signer.to_digestable(origin)) if rrsig.labels < len(rrname) - 1: suffix = rrname.split(rrsig.labels + 1)[1] rrname = dns.name.from_text('*', suffix) rrnamebuf = rrname.to_digestable(origin) rrfixed = struct.pack('!HHI', rdataset.rdtype, rdataset.rdclass, rrsig.original_ttl) rrlist = sorted(rdataset) for rr in rrlist: hash.update(rrnamebuf) hash.update(rrfixed) rrdata = rr.to_digestable(origin) rrlen = struct.pack('!H', len(rrdata)) hash.update(rrlen) hash.update(rrdata) digest = hash.digest() if _is_rsa(rrsig.algorithm): # PKCS1 algorithm identifier goop digest = _make_algorithm_id(rrsig.algorithm) + digest padlen = keylen // 8 - len(digest) - 3 digest = struct.pack('!%dB' % (2 + padlen + 1), *([0, 1] + [0xFF] * padlen + [0])) + digest elif _is_dsa(rrsig.algorithm) or _is_ecdsa(rrsig.algorithm): pass else: # Raise here for code clarity; this won't actually ever happen # since if the algorithm is really unknown we'd already have # raised an exception above raise ValidationFailure('unknown algorithm %u' % rrsig.algorithm) if pubkey.verify(digest, sig): return raise ValidationFailure('verify failure') def _validate(rrset, rrsigset, keys, origin=None, now=None): """Validate an RRset @param rrset: The RRset to validate @type rrset: dns.rrset.RRset or (dns.name.Name, dns.rdataset.Rdataset) tuple @param rrsigset: The signature RRset @type rrsigset: dns.rrset.RRset or (dns.name.Name, dns.rdataset.Rdataset) tuple @param keys: The key dictionary. @type keys: a dictionary keyed by dns.name.Name with node or rdataset values @param origin: The origin to use for relative names @type origin: dns.name.Name or None @param now: The time to use when validating the signatures. The default is the current time. @type now: int """ if isinstance(origin, string_types): origin = dns.name.from_text(origin, dns.name.root) if isinstance(rrset, tuple): rrname = rrset[0] else: rrname = rrset.name if isinstance(rrsigset, tuple): rrsigname = rrsigset[0] rrsigrdataset = rrsigset[1] else: rrsigname = rrsigset.name rrsigrdataset = rrsigset rrname = rrname.choose_relativity(origin) rrsigname = rrname.choose_relativity(origin) if rrname != rrsigname: raise ValidationFailure("owner names do not match") for rrsig in rrsigrdataset: try: _validate_rrsig(rrset, rrsig, keys, origin, now) return except ValidationFailure: pass raise ValidationFailure("no RRSIGs validated") def _need_pycrypto(*args, **kwargs): raise NotImplementedError("DNSSEC validation requires pycrypto") try: import Crypto.PublicKey.RSA import Crypto.PublicKey.DSA import Crypto.Util.number validate = _validate validate_rrsig = _validate_rrsig _have_pycrypto = True except ImportError: validate = _need_pycrypto validate_rrsig = _need_pycrypto _have_pycrypto = False try: import ecdsa import ecdsa.ecdsa import ecdsa.ellipticcurve import ecdsa.keys _have_ecdsa = True class ECKeyWrapper(object): def __init__(self, key, key_len): self.key = key self.key_len = key_len def verify(self, digest, sig): diglong = Crypto.Util.number.bytes_to_long(digest) return self.key.pubkey.verifies(diglong, sig) except ImportError: _have_ecdsa = False PK g\4Vf version.pynu [ # Copyright (C) 2003-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. """dnspython release version information.""" MAJOR = 1 MINOR = 15 MICRO = 0 RELEASELEVEL = 0x0f SERIAL = 0 if RELEASELEVEL == 0x0f: version = '%d.%d.%d' % (MAJOR, MINOR, MICRO) elif RELEASELEVEL == 0x00: version = '%d.%d.%dx%d' % \ (MAJOR, MINOR, MICRO, SERIAL) else: version = '%d.%d.%d%x%d' % \ (MAJOR, MINOR, MICRO, RELEASELEVEL, SERIAL) hexversion = MAJOR << 24 | MINOR << 16 | MICRO << 8 | RELEASELEVEL << 4 | \ SERIAL PK g\ 9R resolver.pynu [ # Copyright (C) 2003-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. """DNS stub resolver. @var default_resolver: The default resolver object @type default_resolver: dns.resolver.Resolver object""" import socket import sys import time import random try: import threading as _threading except ImportError: import dummy_threading as _threading import dns.exception import dns.flags import dns.ipv4 import dns.ipv6 import dns.message import dns.name import dns.query import dns.rcode import dns.rdataclass import dns.rdatatype import dns.reversename import dns.tsig from ._compat import xrange, string_types if sys.platform == 'win32': try: import winreg as _winreg except ImportError: import _winreg # pylint: disable=import-error class NXDOMAIN(dns.exception.DNSException): """The DNS query name does not exist.""" supp_kwargs = set(['qnames', 'responses']) fmt = None # we have our own __str__ implementation def _check_kwargs(self, qnames, responses=None): if not isinstance(qnames, (list, tuple, set)): raise AttributeError("qnames must be a list, tuple or set") if len(qnames) == 0: raise AttributeError("qnames must contain at least one element") if responses is None: responses = {} elif not isinstance(responses, dict): raise AttributeError("responses must be a dict(qname=response)") kwargs = dict(qnames=qnames, responses=responses) return kwargs def __str__(self): if 'qnames' not in self.kwargs: return super(NXDOMAIN, self).__str__() qnames = self.kwargs['qnames'] if len(qnames) > 1: msg = 'None of DNS query names exist' else: msg = self.__doc__[:-1] qnames = ', '.join(map(str, qnames)) return "%s: %s" % (msg, qnames) def canonical_name(self): if not 'qnames' in self.kwargs: raise TypeError("parametrized exception required") IN = dns.rdataclass.IN CNAME = dns.rdatatype.CNAME cname = None for qname in self.kwargs['qnames']: response = self.kwargs['responses'][qname] for answer in response.answer: if answer.rdtype != CNAME or answer.rdclass != IN: continue cname = answer.items[0].target.to_text() if cname is not None: return dns.name.from_text(cname) return self.kwargs['qnames'][0] canonical_name = property(canonical_name, doc=( "Return the unresolved canonical name.")) def __add__(self, e_nx): """Augment by results from another NXDOMAIN exception.""" qnames0 = list(self.kwargs.get('qnames', [])) responses0 = dict(self.kwargs.get('responses', {})) responses1 = e_nx.kwargs.get('responses', {}) for qname1 in e_nx.kwargs.get('qnames', []): if qname1 not in qnames0: qnames0.append(qname1) if qname1 in responses1: responses0[qname1] = responses1[qname1] return NXDOMAIN(qnames=qnames0, responses=responses0) class YXDOMAIN(dns.exception.DNSException): """The DNS query name is too long after DNAME substitution.""" # The definition of the Timeout exception has moved from here to the # dns.exception module. We keep dns.resolver.Timeout defined for # backwards compatibility. Timeout = dns.exception.Timeout class NoAnswer(dns.exception.DNSException): """The DNS response does not contain an answer to the question.""" fmt = 'The DNS response does not contain an answer ' + \ 'to the question: {query}' supp_kwargs = set(['response']) def _fmt_kwargs(self, **kwargs): return super(NoAnswer, self)._fmt_kwargs( query=kwargs['response'].question) class NoNameservers(dns.exception.DNSException): """All nameservers failed to answer the query. errors: list of servers and respective errors The type of errors is [(server ip address, any object convertible to string)]. Non-empty errors list will add explanatory message () """ msg = "All nameservers failed to answer the query." fmt = "%s {query}: {errors}" % msg[:-1] supp_kwargs = set(['request', 'errors']) def _fmt_kwargs(self, **kwargs): srv_msgs = [] for err in kwargs['errors']: srv_msgs.append('Server %s %s port %s answered %s' % (err[0], 'TCP' if err[1] else 'UDP', err[2], err[3])) return super(NoNameservers, self)._fmt_kwargs( query=kwargs['request'].question, errors='; '.join(srv_msgs)) class NotAbsolute(dns.exception.DNSException): """An absolute domain name is required but a relative name was provided.""" class NoRootSOA(dns.exception.DNSException): """There is no SOA RR at the DNS root name. This should never happen!""" class NoMetaqueries(dns.exception.DNSException): """DNS metaqueries are not allowed.""" class Answer(object): """DNS stub resolver answer Instances of this class bundle up the result of a successful DNS resolution. For convenience, the answer object implements much of the sequence protocol, forwarding to its rrset. E.g. "for a in answer" is equivalent to "for a in answer.rrset", "answer[i]" is equivalent to "answer.rrset[i]", and "answer[i:j]" is equivalent to "answer.rrset[i:j]". Note that CNAMEs or DNAMEs in the response may mean that answer node's name might not be the query name. @ivar qname: The query name @type qname: dns.name.Name object @ivar rdtype: The query type @type rdtype: int @ivar rdclass: The query class @type rdclass: int @ivar response: The response message @type response: dns.message.Message object @ivar rrset: The answer @type rrset: dns.rrset.RRset object @ivar expiration: The time when the answer expires @type expiration: float (seconds since the epoch) @ivar canonical_name: The canonical name of the query name @type canonical_name: dns.name.Name object """ def __init__(self, qname, rdtype, rdclass, response, raise_on_no_answer=True): self.qname = qname self.rdtype = rdtype self.rdclass = rdclass self.response = response min_ttl = -1 rrset = None for count in xrange(0, 15): try: rrset = response.find_rrset(response.answer, qname, rdclass, rdtype) if min_ttl == -1 or rrset.ttl < min_ttl: min_ttl = rrset.ttl break except KeyError: if rdtype != dns.rdatatype.CNAME: try: crrset = response.find_rrset(response.answer, qname, rdclass, dns.rdatatype.CNAME) if min_ttl == -1 or crrset.ttl < min_ttl: min_ttl = crrset.ttl for rd in crrset: qname = rd.target break continue except KeyError: if raise_on_no_answer: raise NoAnswer(response=response) if raise_on_no_answer: raise NoAnswer(response=response) if rrset is None and raise_on_no_answer: raise NoAnswer(response=response) self.canonical_name = qname self.rrset = rrset if rrset is None: while 1: # Look for a SOA RR whose owner name is a superdomain # of qname. try: srrset = response.find_rrset(response.authority, qname, rdclass, dns.rdatatype.SOA) if min_ttl == -1 or srrset.ttl < min_ttl: min_ttl = srrset.ttl if srrset[0].minimum < min_ttl: min_ttl = srrset[0].minimum break except KeyError: try: qname = qname.parent() except dns.name.NoParent: break self.expiration = time.time() + min_ttl def __getattr__(self, attr): if attr == 'name': return self.rrset.name elif attr == 'ttl': return self.rrset.ttl elif attr == 'covers': return self.rrset.covers elif attr == 'rdclass': return self.rrset.rdclass elif attr == 'rdtype': return self.rrset.rdtype else: raise AttributeError(attr) def __len__(self): return self.rrset and len(self.rrset) or 0 def __iter__(self): return self.rrset and iter(self.rrset) or iter(tuple()) def __getitem__(self, i): return self.rrset[i] def __delitem__(self, i): del self.rrset[i] class Cache(object): """Simple DNS answer cache. @ivar data: A dictionary of cached data @type data: dict @ivar cleaning_interval: The number of seconds between cleanings. The default is 300 (5 minutes). @type cleaning_interval: float @ivar next_cleaning: The time the cache should next be cleaned (in seconds since the epoch.) @type next_cleaning: float """ def __init__(self, cleaning_interval=300.0): """Initialize a DNS cache. @param cleaning_interval: the number of seconds between periodic cleanings. The default is 300.0 @type cleaning_interval: float. """ self.data = {} self.cleaning_interval = cleaning_interval self.next_cleaning = time.time() + self.cleaning_interval self.lock = _threading.Lock() def _maybe_clean(self): """Clean the cache if it's time to do so.""" now = time.time() if self.next_cleaning <= now: keys_to_delete = [] for (k, v) in self.data.items(): if v.expiration <= now: keys_to_delete.append(k) for k in keys_to_delete: del self.data[k] now = time.time() self.next_cleaning = now + self.cleaning_interval def get(self, key): """Get the answer associated with I{key}. Returns None if no answer is cached for the key. @param key: the key @type key: (dns.name.Name, int, int) tuple whose values are the query name, rdtype, and rdclass. @rtype: dns.resolver.Answer object or None """ try: self.lock.acquire() self._maybe_clean() v = self.data.get(key) if v is None or v.expiration <= time.time(): return None return v finally: self.lock.release() def put(self, key, value): """Associate key and value in the cache. @param key: the key @type key: (dns.name.Name, int, int) tuple whose values are the query name, rdtype, and rdclass. @param value: The answer being cached @type value: dns.resolver.Answer object """ try: self.lock.acquire() self._maybe_clean() self.data[key] = value finally: self.lock.release() def flush(self, key=None): """Flush the cache. If I{key} is specified, only that item is flushed. Otherwise the entire cache is flushed. @param key: the key to flush @type key: (dns.name.Name, int, int) tuple or None """ try: self.lock.acquire() if key is not None: if key in self.data: del self.data[key] else: self.data = {} self.next_cleaning = time.time() + self.cleaning_interval finally: self.lock.release() class LRUCacheNode(object): """LRUCache node. """ def __init__(self, key, value): self.key = key self.value = value self.prev = self self.next = self def link_before(self, node): self.prev = node.prev self.next = node node.prev.next = self node.prev = self def link_after(self, node): self.prev = node self.next = node.next node.next.prev = self node.next = self def unlink(self): self.next.prev = self.prev self.prev.next = self.next class LRUCache(object): """Bounded least-recently-used DNS answer cache. This cache is better than the simple cache (above) if you're running a web crawler or other process that does a lot of resolutions. The LRUCache has a maximum number of nodes, and when it is full, the least-recently used node is removed to make space for a new one. @ivar data: A dictionary of cached data @type data: dict @ivar sentinel: sentinel node for circular doubly linked list of nodes @type sentinel: LRUCacheNode object @ivar max_size: The maximum number of nodes @type max_size: int """ def __init__(self, max_size=100000): """Initialize a DNS cache. @param max_size: The maximum number of nodes to cache; the default is 100,000. Must be greater than 1. @type max_size: int """ self.data = {} self.set_max_size(max_size) self.sentinel = LRUCacheNode(None, None) self.lock = _threading.Lock() def set_max_size(self, max_size): if max_size < 1: max_size = 1 self.max_size = max_size def get(self, key): """Get the answer associated with I{key}. Returns None if no answer is cached for the key. @param key: the key @type key: (dns.name.Name, int, int) tuple whose values are the query name, rdtype, and rdclass. @rtype: dns.resolver.Answer object or None """ try: self.lock.acquire() node = self.data.get(key) if node is None: return None # Unlink because we're either going to move the node to the front # of the LRU list or we're going to free it. node.unlink() if node.value.expiration <= time.time(): del self.data[node.key] return None node.link_after(self.sentinel) return node.value finally: self.lock.release() def put(self, key, value): """Associate key and value in the cache. @param key: the key @type key: (dns.name.Name, int, int) tuple whose values are the query name, rdtype, and rdclass. @param value: The answer being cached @type value: dns.resolver.Answer object """ try: self.lock.acquire() node = self.data.get(key) if node is not None: node.unlink() del self.data[node.key] while len(self.data) >= self.max_size: node = self.sentinel.prev node.unlink() del self.data[node.key] node = LRUCacheNode(key, value) node.link_after(self.sentinel) self.data[key] = node finally: self.lock.release() def flush(self, key=None): """Flush the cache. If I{key} is specified, only that item is flushed. Otherwise the entire cache is flushed. @param key: the key to flush @type key: (dns.name.Name, int, int) tuple or None """ try: self.lock.acquire() if key is not None: node = self.data.get(key) if node is not None: node.unlink() del self.data[node.key] else: node = self.sentinel.next while node != self.sentinel: next = node.next node.prev = None node.next = None node = next self.data = {} finally: self.lock.release() class Resolver(object): """DNS stub resolver @ivar domain: The domain of this host @type domain: dns.name.Name object @ivar nameservers: A list of nameservers to query. Each nameserver is a string which contains the IP address of a nameserver. @type nameservers: list of strings @ivar search: The search list. If the query name is a relative name, the resolver will construct an absolute query name by appending the search names one by one to the query name. @type search: list of dns.name.Name objects @ivar port: The port to which to send queries. The default is 53. @type port: int @ivar timeout: The number of seconds to wait for a response from a server, before timing out. @type timeout: float @ivar lifetime: The total number of seconds to spend trying to get an answer to the question. If the lifetime expires, a Timeout exception will occur. @type lifetime: float @ivar keyring: The TSIG keyring to use. The default is None. @type keyring: dict @ivar keyname: The TSIG keyname to use. The default is None. @type keyname: dns.name.Name object @ivar keyalgorithm: The TSIG key algorithm to use. The default is dns.tsig.default_algorithm. @type keyalgorithm: string @ivar edns: The EDNS level to use. The default is -1, no Edns. @type edns: int @ivar ednsflags: The EDNS flags @type ednsflags: int @ivar payload: The EDNS payload size. The default is 0. @type payload: int @ivar flags: The message flags to use. The default is None (i.e. not overwritten) @type flags: int @ivar cache: The cache to use. The default is None. @type cache: dns.resolver.Cache object @ivar retry_servfail: should we retry a nameserver if it says SERVFAIL? The default is 'false'. @type retry_servfail: bool """ def __init__(self, filename='/etc/resolv.conf', configure=True): """Initialize a resolver instance. @param filename: The filename of a configuration file in standard /etc/resolv.conf format. This parameter is meaningful only when I{configure} is true and the platform is POSIX. @type filename: string or file object @param configure: If True (the default), the resolver instance is configured in the normal fashion for the operating system the resolver is running on. (I.e. a /etc/resolv.conf file on POSIX systems and from the registry on Windows systems.) @type configure: bool""" self.domain = None self.nameservers = None self.nameserver_ports = None self.port = None self.search = None self.timeout = None self.lifetime = None self.keyring = None self.keyname = None self.keyalgorithm = None self.edns = None self.ednsflags = None self.payload = None self.cache = None self.flags = None self.retry_servfail = False self.rotate = False self.reset() if configure: if sys.platform == 'win32': self.read_registry() elif filename: self.read_resolv_conf(filename) def reset(self): """Reset all resolver configuration to the defaults.""" self.domain = \ dns.name.Name(dns.name.from_text(socket.gethostname())[1:]) if len(self.domain) == 0: self.domain = dns.name.root self.nameservers = [] self.nameserver_ports = {} self.port = 53 self.search = [] self.timeout = 2.0 self.lifetime = 30.0 self.keyring = None self.keyname = None self.keyalgorithm = dns.tsig.default_algorithm self.edns = -1 self.ednsflags = 0 self.payload = 0 self.cache = None self.flags = None self.retry_servfail = False self.rotate = False def read_resolv_conf(self, f): """Process f as a file in the /etc/resolv.conf format. If f is a string, it is used as the name of the file to open; otherwise it is treated as the file itself.""" if isinstance(f, string_types): try: f = open(f, 'r') except IOError: # /etc/resolv.conf doesn't exist, can't be read, etc. # We'll just use the default resolver configuration. self.nameservers = ['127.0.0.1'] return want_close = True else: want_close = False try: for l in f: if len(l) == 0 or l[0] == '#' or l[0] == ';': continue tokens = l.split() # Any line containing less than 2 tokens is malformed if len(tokens) < 2: continue if tokens[0] == 'nameserver': self.nameservers.append(tokens[1]) elif tokens[0] == 'domain': self.domain = dns.name.from_text(tokens[1]) elif tokens[0] == 'search': for suffix in tokens[1:]: self.search.append(dns.name.from_text(suffix)) elif tokens[0] == 'options': if 'rotate' in tokens[1:]: self.rotate = True finally: if want_close: f.close() if len(self.nameservers) == 0: self.nameservers.append('127.0.0.1') def _determine_split_char(self, entry): # # The windows registry irritatingly changes the list element # delimiter in between ' ' and ',' (and vice-versa) in various # versions of windows. # if entry.find(' ') >= 0: split_char = ' ' elif entry.find(',') >= 0: split_char = ',' else: # probably a singleton; treat as a space-separated list. split_char = ' ' return split_char def _config_win32_nameservers(self, nameservers): """Configure a NameServer registry entry.""" # we call str() on nameservers to convert it from unicode to ascii nameservers = str(nameservers) split_char = self._determine_split_char(nameservers) ns_list = nameservers.split(split_char) for ns in ns_list: if ns not in self.nameservers: self.nameservers.append(ns) def _config_win32_domain(self, domain): """Configure a Domain registry entry.""" # we call str() on domain to convert it from unicode to ascii self.domain = dns.name.from_text(str(domain)) def _config_win32_search(self, search): """Configure a Search registry entry.""" # we call str() on search to convert it from unicode to ascii search = str(search) split_char = self._determine_split_char(search) search_list = search.split(split_char) for s in search_list: if s not in self.search: self.search.append(dns.name.from_text(s)) def _config_win32_fromkey(self, key): """Extract DNS info from a registry key.""" try: servers, rtype = _winreg.QueryValueEx(key, 'NameServer') except WindowsError: # pylint: disable=undefined-variable servers = None if servers: self._config_win32_nameservers(servers) try: dom, rtype = _winreg.QueryValueEx(key, 'Domain') if dom: self._config_win32_domain(dom) except WindowsError: # pylint: disable=undefined-variable pass else: try: servers, rtype = _winreg.QueryValueEx(key, 'DhcpNameServer') except WindowsError: # pylint: disable=undefined-variable servers = None if servers: self._config_win32_nameservers(servers) try: dom, rtype = _winreg.QueryValueEx(key, 'DhcpDomain') if dom: self._config_win32_domain(dom) except WindowsError: # pylint: disable=undefined-variable pass try: search, rtype = _winreg.QueryValueEx(key, 'SearchList') except WindowsError: # pylint: disable=undefined-variable search = None if search: self._config_win32_search(search) def read_registry(self): """Extract resolver configuration from the Windows registry.""" lm = _winreg.ConnectRegistry(None, _winreg.HKEY_LOCAL_MACHINE) want_scan = False try: try: # XP, 2000 tcp_params = _winreg.OpenKey(lm, r'SYSTEM\CurrentControlSet' r'\Services\Tcpip\Parameters') want_scan = True except EnvironmentError: # ME tcp_params = _winreg.OpenKey(lm, r'SYSTEM\CurrentControlSet' r'\Services\VxD\MSTCP') try: self._config_win32_fromkey(tcp_params) finally: tcp_params.Close() if want_scan: interfaces = _winreg.OpenKey(lm, r'SYSTEM\CurrentControlSet' r'\Services\Tcpip\Parameters' r'\Interfaces') try: i = 0 while True: try: guid = _winreg.EnumKey(interfaces, i) i += 1 key = _winreg.OpenKey(interfaces, guid) if not self._win32_is_nic_enabled(lm, guid, key): continue try: self._config_win32_fromkey(key) finally: key.Close() except EnvironmentError: break finally: interfaces.Close() finally: lm.Close() def _win32_is_nic_enabled(self, lm, guid, interface_key): # Look in the Windows Registry to determine whether the network # interface corresponding to the given guid is enabled. # # (Code contributed by Paul Marks, thanks!) # try: # This hard-coded location seems to be consistent, at least # from Windows 2000 through Vista. connection_key = _winreg.OpenKey( lm, r'SYSTEM\CurrentControlSet\Control\Network' r'\{4D36E972-E325-11CE-BFC1-08002BE10318}' r'\%s\Connection' % guid) try: # The PnpInstanceID points to a key inside Enum (pnp_id, ttype) = _winreg.QueryValueEx( connection_key, 'PnpInstanceID') if ttype != _winreg.REG_SZ: raise ValueError device_key = _winreg.OpenKey( lm, r'SYSTEM\CurrentControlSet\Enum\%s' % pnp_id) try: # Get ConfigFlags for this device (flags, ttype) = _winreg.QueryValueEx( device_key, 'ConfigFlags') if ttype != _winreg.REG_DWORD: raise ValueError # Based on experimentation, bit 0x1 indicates that the # device is disabled. return not flags & 0x1 finally: device_key.Close() finally: connection_key.Close() except (EnvironmentError, ValueError): # Pre-vista, enabled interfaces seem to have a non-empty # NTEContextList; this was how dnspython detected enabled # nics before the code above was contributed. We've retained # the old method since we don't know if the code above works # on Windows 95/98/ME. try: (nte, ttype) = _winreg.QueryValueEx(interface_key, 'NTEContextList') return nte is not None except WindowsError: # pylint: disable=undefined-variable return False def _compute_timeout(self, start): now = time.time() duration = now - start if duration < 0: if duration < -1: # Time going backwards is bad. Just give up. raise Timeout(timeout=duration) else: # Time went backwards, but only a little. This can # happen, e.g. under vmware with older linux kernels. # Pretend it didn't happen. now = start if duration >= self.lifetime: raise Timeout(timeout=duration) return min(self.lifetime - duration, self.timeout) def query(self, qname, rdtype=dns.rdatatype.A, rdclass=dns.rdataclass.IN, tcp=False, source=None, raise_on_no_answer=True, source_port=0): """Query nameservers to find the answer to the question. The I{qname}, I{rdtype}, and I{rdclass} parameters may be objects of the appropriate type, or strings that can be converted into objects of the appropriate type. E.g. For I{rdtype} the integer 2 and the the string 'NS' both mean to query for records with DNS rdata type NS. @param qname: the query name @type qname: dns.name.Name object or string @param rdtype: the query type @type rdtype: int or string @param rdclass: the query class @type rdclass: int or string @param tcp: use TCP to make the query (default is False). @type tcp: bool @param source: bind to this IP address (defaults to machine default IP). @type source: IP address in dotted quad notation @param raise_on_no_answer: raise NoAnswer if there's no answer (defaults is True). @type raise_on_no_answer: bool @param source_port: The port from which to send the message. The default is 0. @type source_port: int @rtype: dns.resolver.Answer instance @raises Timeout: no answers could be found in the specified lifetime @raises NXDOMAIN: the query name does not exist @raises YXDOMAIN: the query name is too long after DNAME substitution @raises NoAnswer: the response did not contain an answer and raise_on_no_answer is True. @raises NoNameservers: no non-broken nameservers are available to answer the question.""" if isinstance(qname, string_types): qname = dns.name.from_text(qname, None) if isinstance(rdtype, string_types): rdtype = dns.rdatatype.from_text(rdtype) if dns.rdatatype.is_metatype(rdtype): raise NoMetaqueries if isinstance(rdclass, string_types): rdclass = dns.rdataclass.from_text(rdclass) if dns.rdataclass.is_metaclass(rdclass): raise NoMetaqueries qnames_to_try = [] if qname.is_absolute(): qnames_to_try.append(qname) else: if len(qname) > 1: qnames_to_try.append(qname.concatenate(dns.name.root)) if self.search: for suffix in self.search: qnames_to_try.append(qname.concatenate(suffix)) else: qnames_to_try.append(qname.concatenate(self.domain)) all_nxdomain = True nxdomain_responses = {} start = time.time() _qname = None # make pylint happy for _qname in qnames_to_try: if self.cache: answer = self.cache.get((_qname, rdtype, rdclass)) if answer is not None: if answer.rrset is None and raise_on_no_answer: raise NoAnswer(response=answer.response) else: return answer request = dns.message.make_query(_qname, rdtype, rdclass) if self.keyname is not None: request.use_tsig(self.keyring, self.keyname, algorithm=self.keyalgorithm) request.use_edns(self.edns, self.ednsflags, self.payload) if self.flags is not None: request.flags = self.flags response = None # # make a copy of the servers list so we can alter it later. # nameservers = self.nameservers[:] errors = [] if self.rotate: random.shuffle(nameservers) backoff = 0.10 while response is None: if len(nameservers) == 0: raise NoNameservers(request=request, errors=errors) for nameserver in nameservers[:]: timeout = self._compute_timeout(start) port = self.nameserver_ports.get(nameserver, self.port) try: tcp_attempt = tcp if tcp: response = dns.query.tcp(request, nameserver, timeout, port, source=source, source_port=source_port) else: response = dns.query.udp(request, nameserver, timeout, port, source=source, source_port=source_port) if response.flags & dns.flags.TC: # Response truncated; retry with TCP. tcp_attempt = True timeout = self._compute_timeout(start) response = \ dns.query.tcp(request, nameserver, timeout, port, source=source, source_port=source_port) except (socket.error, dns.exception.Timeout) as ex: # # Communication failure or timeout. Go to the # next server # errors.append((nameserver, tcp_attempt, port, ex, response)) response = None continue except dns.query.UnexpectedSource as ex: # # Who knows? Keep going. # errors.append((nameserver, tcp_attempt, port, ex, response)) response = None continue except dns.exception.FormError as ex: # # We don't understand what this server is # saying. Take it out of the mix and # continue. # nameservers.remove(nameserver) errors.append((nameserver, tcp_attempt, port, ex, response)) response = None continue except EOFError as ex: # # We're using TCP and they hung up on us. # Probably they don't support TCP (though # they're supposed to!). Take it out of the # mix and continue. # nameservers.remove(nameserver) errors.append((nameserver, tcp_attempt, port, ex, response)) response = None continue rcode = response.rcode() if rcode == dns.rcode.YXDOMAIN: ex = YXDOMAIN() errors.append((nameserver, tcp_attempt, port, ex, response)) raise ex if rcode == dns.rcode.NOERROR or \ rcode == dns.rcode.NXDOMAIN: break # # We got a response, but we're not happy with the # rcode in it. Remove the server from the mix if # the rcode isn't SERVFAIL. # if rcode != dns.rcode.SERVFAIL or not self.retry_servfail: nameservers.remove(nameserver) errors.append((nameserver, tcp_attempt, port, dns.rcode.to_text(rcode), response)) response = None if response is not None: break # # All nameservers failed! # if len(nameservers) > 0: # # But we still have servers to try. Sleep a bit # so we don't pound them! # timeout = self._compute_timeout(start) sleep_time = min(timeout, backoff) backoff *= 2 time.sleep(sleep_time) if response.rcode() == dns.rcode.NXDOMAIN: nxdomain_responses[_qname] = response continue all_nxdomain = False break if all_nxdomain: raise NXDOMAIN(qnames=qnames_to_try, responses=nxdomain_responses) answer = Answer(_qname, rdtype, rdclass, response, raise_on_no_answer) if self.cache: self.cache.put((_qname, rdtype, rdclass), answer) return answer def use_tsig(self, keyring, keyname=None, algorithm=dns.tsig.default_algorithm): """Add a TSIG signature to the query. @param keyring: The TSIG keyring to use; defaults to None. @type keyring: dict @param keyname: The name of the TSIG key to use; defaults to None. The key must be defined in the keyring. If a keyring is specified but a keyname is not, then the key used will be the first key in the keyring. Note that the order of keys in a dictionary is not defined, so applications should supply a keyname when a keyring is used, unless they know the keyring contains only one key. @param algorithm: The TSIG key algorithm to use. The default is dns.tsig.default_algorithm. @type algorithm: string""" self.keyring = keyring if keyname is None: self.keyname = list(self.keyring.keys())[0] else: self.keyname = keyname self.keyalgorithm = algorithm def use_edns(self, edns, ednsflags, payload): """Configure Edns. @param edns: The EDNS level to use. The default is -1, no Edns. @type edns: int @param ednsflags: The EDNS flags @type ednsflags: int @param payload: The EDNS payload size. The default is 0. @type payload: int""" if edns is None: edns = -1 self.edns = edns self.ednsflags = ednsflags self.payload = payload def set_flags(self, flags): """Overrides the default flags with your own @param flags: The flags to overwrite the default with @type flags: int""" self.flags = flags default_resolver = None def get_default_resolver(): """Get the default resolver, initializing it if necessary.""" if default_resolver is None: reset_default_resolver() return default_resolver def reset_default_resolver(): """Re-initialize default resolver. resolv.conf will be re-read immediatelly. """ global default_resolver default_resolver = Resolver() def query(qname, rdtype=dns.rdatatype.A, rdclass=dns.rdataclass.IN, tcp=False, source=None, raise_on_no_answer=True, source_port=0): """Query nameservers to find the answer to the question. This is a convenience function that uses the default resolver object to make the query. @see: L{dns.resolver.Resolver.query} for more information on the parameters.""" return get_default_resolver().query(qname, rdtype, rdclass, tcp, source, raise_on_no_answer, source_port) def zone_for_name(name, rdclass=dns.rdataclass.IN, tcp=False, resolver=None): """Find the name of the zone which contains the specified name. @param name: the query name @type name: absolute dns.name.Name object or string @param rdclass: The query class @type rdclass: int @param tcp: use TCP to make the query (default is False). @type tcp: bool @param resolver: the resolver to use @type resolver: dns.resolver.Resolver object or None @rtype: dns.name.Name""" if isinstance(name, string_types): name = dns.name.from_text(name, dns.name.root) if resolver is None: resolver = get_default_resolver() if not name.is_absolute(): raise NotAbsolute(name) while 1: try: answer = resolver.query(name, dns.rdatatype.SOA, rdclass, tcp) if answer.rrset.name == name: return name # otherwise we were CNAMEd or DNAMEd and need to look higher except (dns.resolver.NXDOMAIN, dns.resolver.NoAnswer): pass try: name = name.parent() except dns.name.NoParent: raise NoRootSOA # # Support for overriding the system resolver for all python code in the # running process. # _protocols_for_socktype = { socket.SOCK_DGRAM: [socket.SOL_UDP], socket.SOCK_STREAM: [socket.SOL_TCP], } _resolver = None _original_getaddrinfo = socket.getaddrinfo _original_getnameinfo = socket.getnameinfo _original_getfqdn = socket.getfqdn _original_gethostbyname = socket.gethostbyname _original_gethostbyname_ex = socket.gethostbyname_ex _original_gethostbyaddr = socket.gethostbyaddr def _getaddrinfo(host=None, service=None, family=socket.AF_UNSPEC, socktype=0, proto=0, flags=0): if flags & (socket.AI_ADDRCONFIG | socket.AI_V4MAPPED) != 0: raise NotImplementedError if host is None and service is None: raise socket.gaierror(socket.EAI_NONAME) v6addrs = [] v4addrs = [] canonical_name = None try: # Is host None or a V6 address literal? if host is None: canonical_name = 'localhost' if flags & socket.AI_PASSIVE != 0: v6addrs.append('::') v4addrs.append('0.0.0.0') else: v6addrs.append('::1') v4addrs.append('127.0.0.1') else: parts = host.split('%') if len(parts) == 2: ahost = parts[0] else: ahost = host addr = dns.ipv6.inet_aton(ahost) v6addrs.append(host) canonical_name = host except Exception: try: # Is it a V4 address literal? addr = dns.ipv4.inet_aton(host) v4addrs.append(host) canonical_name = host except Exception: if flags & socket.AI_NUMERICHOST == 0: try: if family == socket.AF_INET6 or family == socket.AF_UNSPEC: v6 = _resolver.query(host, dns.rdatatype.AAAA, raise_on_no_answer=False) # Note that setting host ensures we query the same name # for A as we did for AAAA. host = v6.qname canonical_name = v6.canonical_name.to_text(True) if v6.rrset is not None: for rdata in v6.rrset: v6addrs.append(rdata.address) if family == socket.AF_INET or family == socket.AF_UNSPEC: v4 = _resolver.query(host, dns.rdatatype.A, raise_on_no_answer=False) host = v4.qname canonical_name = v4.canonical_name.to_text(True) if v4.rrset is not None: for rdata in v4.rrset: v4addrs.append(rdata.address) except dns.resolver.NXDOMAIN: raise socket.gaierror(socket.EAI_NONAME) except: raise socket.gaierror(socket.EAI_SYSTEM) port = None try: # Is it a port literal? if service is None: port = 0 else: port = int(service) except Exception: if flags & socket.AI_NUMERICSERV == 0: try: port = socket.getservbyname(service) except Exception: pass if port is None: raise socket.gaierror(socket.EAI_NONAME) tuples = [] if socktype == 0: socktypes = [socket.SOCK_DGRAM, socket.SOCK_STREAM] else: socktypes = [socktype] if flags & socket.AI_CANONNAME != 0: cname = canonical_name else: cname = '' if family == socket.AF_INET6 or family == socket.AF_UNSPEC: for addr in v6addrs: for socktype in socktypes: for proto in _protocols_for_socktype[socktype]: tuples.append((socket.AF_INET6, socktype, proto, cname, (addr, port, 0, 0))) if family == socket.AF_INET or family == socket.AF_UNSPEC: for addr in v4addrs: for socktype in socktypes: for proto in _protocols_for_socktype[socktype]: tuples.append((socket.AF_INET, socktype, proto, cname, (addr, port))) if len(tuples) == 0: raise socket.gaierror(socket.EAI_NONAME) return tuples def _getnameinfo(sockaddr, flags=0): host = sockaddr[0] port = sockaddr[1] if len(sockaddr) == 4: scope = sockaddr[3] family = socket.AF_INET6 else: scope = None family = socket.AF_INET tuples = _getaddrinfo(host, port, family, socket.SOCK_STREAM, socket.SOL_TCP, 0) if len(tuples) > 1: raise socket.error('sockaddr resolved to multiple addresses') addr = tuples[0][4][0] if flags & socket.NI_DGRAM: pname = 'udp' else: pname = 'tcp' qname = dns.reversename.from_address(addr) if flags & socket.NI_NUMERICHOST == 0: try: answer = _resolver.query(qname, 'PTR') hostname = answer.rrset[0].target.to_text(True) except (dns.resolver.NXDOMAIN, dns.resolver.NoAnswer): if flags & socket.NI_NAMEREQD: raise socket.gaierror(socket.EAI_NONAME) hostname = addr if scope is not None: hostname += '%' + str(scope) else: hostname = addr if scope is not None: hostname += '%' + str(scope) if flags & socket.NI_NUMERICSERV: service = str(port) else: service = socket.getservbyport(port, pname) return (hostname, service) def _getfqdn(name=None): if name is None: name = socket.gethostname() try: return _getnameinfo(_getaddrinfo(name, 80)[0][4])[0] except Exception: return name def _gethostbyname(name): return _gethostbyname_ex(name)[2][0] def _gethostbyname_ex(name): aliases = [] addresses = [] tuples = _getaddrinfo(name, 0, socket.AF_INET, socket.SOCK_STREAM, socket.SOL_TCP, socket.AI_CANONNAME) canonical = tuples[0][3] for item in tuples: addresses.append(item[4][0]) # XXX we just ignore aliases return (canonical, aliases, addresses) def _gethostbyaddr(ip): try: dns.ipv6.inet_aton(ip) sockaddr = (ip, 80, 0, 0) family = socket.AF_INET6 except Exception: sockaddr = (ip, 80) family = socket.AF_INET (name, port) = _getnameinfo(sockaddr, socket.NI_NAMEREQD) aliases = [] addresses = [] tuples = _getaddrinfo(name, 0, family, socket.SOCK_STREAM, socket.SOL_TCP, socket.AI_CANONNAME) canonical = tuples[0][3] for item in tuples: addresses.append(item[4][0]) # XXX we just ignore aliases return (canonical, aliases, addresses) def override_system_resolver(resolver=None): """Override the system resolver routines in the socket module with versions which use dnspython's resolver. This can be useful in testing situations where you want to control the resolution behavior of python code without having to change the system's resolver settings (e.g. /etc/resolv.conf). The resolver to use may be specified; if it's not, the default resolver will be used. @param resolver: the resolver to use @type resolver: dns.resolver.Resolver object or None """ if resolver is None: resolver = get_default_resolver() global _resolver _resolver = resolver socket.getaddrinfo = _getaddrinfo socket.getnameinfo = _getnameinfo socket.getfqdn = _getfqdn socket.gethostbyname = _gethostbyname socket.gethostbyname_ex = _gethostbyname_ex socket.gethostbyaddr = _gethostbyaddr def restore_system_resolver(): """Undo the effects of override_system_resolver(). """ global _resolver _resolver = None socket.getaddrinfo = _original_getaddrinfo socket.getnameinfo = _original_getnameinfo socket.getfqdn = _original_getfqdn socket.gethostbyname = _original_gethostbyname socket.gethostbyname_ex = _original_gethostbyname_ex socket.gethostbyaddr = _original_gethostbyaddr PK g\)! ! _compat.pynu [ import sys import decimal from decimal import Context if sys.version_info > (3,): long = int xrange = range else: long = long # pylint: disable=long-builtin xrange = xrange # pylint: disable=xrange-builtin # unicode / binary types if sys.version_info > (3,): text_type = str binary_type = bytes string_types = (str,) unichr = chr def maybe_decode(x): return x.decode() def maybe_encode(x): return x.encode() else: text_type = unicode # pylint: disable=unicode-builtin, undefined-variable binary_type = str string_types = ( basestring, # pylint: disable=basestring-builtin, undefined-variable ) unichr = unichr # pylint: disable=unichr-builtin def maybe_decode(x): return x def maybe_encode(x): return x def round_py2_compat(what): """ Python 2 and Python 3 use different rounding strategies in round(). This function ensures that results are python2/3 compatible and backward compatible with previous py2 releases :param what: float :return: rounded long """ d = Context( prec=len(str(long(what))), # round to integer with max precision rounding=decimal.ROUND_HALF_UP ).create_decimal(str(what)) # str(): python 2.6 compat return long(d) PK g\˸ ipv4.pynu [ # Copyright (C) 2003-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. """IPv4 helper functions.""" import struct import dns.exception from ._compat import binary_type def inet_ntoa(address): """Convert an IPv4 address in network form to text form. @param address: The IPv4 address @type address: string @returns: string """ if len(address) != 4: raise dns.exception.SyntaxError if not isinstance(address, bytearray): address = bytearray(address) return (u'%u.%u.%u.%u' % (address[0], address[1], address[2], address[3])).encode() def inet_aton(text): """Convert an IPv4 address in text form to network form. @param text: The IPv4 address @type text: string @returns: string """ if not isinstance(text, binary_type): text = text.encode() parts = text.split(b'.') if len(parts) != 4: raise dns.exception.SyntaxError for part in parts: if not part.isdigit(): raise dns.exception.SyntaxError if len(part) > 1 and part[0] == '0': # No leading zeros raise dns.exception.SyntaxError try: bytes = [int(part) for part in parts] return struct.pack('BBBB', *bytes) except: raise dns.exception.SyntaxError PK g\/XO node.pynu [ # Copyright (C) 2001-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. """DNS nodes. A node is a set of rdatasets.""" from io import StringIO import dns.rdataset import dns.rdatatype import dns.renderer class Node(object): """A DNS node. A node is a set of rdatasets @ivar rdatasets: the node's rdatasets @type rdatasets: list of dns.rdataset.Rdataset objects""" __slots__ = ['rdatasets'] def __init__(self): """Initialize a DNS node. """ self.rdatasets = [] def to_text(self, name, **kw): """Convert a node to text format. Each rdataset at the node is printed. Any keyword arguments to this method are passed on to the rdataset's to_text() method. @param name: the owner name of the rdatasets @type name: dns.name.Name object @rtype: string """ s = StringIO() for rds in self.rdatasets: if len(rds) > 0: s.write(rds.to_text(name, **kw)) s.write(u'\n') return s.getvalue()[:-1] def __repr__(self): return '<DNS node ' + str(id(self)) + '>' def __eq__(self, other): """Two nodes are equal if they have the same rdatasets. @rtype: bool """ # # This is inefficient. Good thing we don't need to do it much. # for rd in self.rdatasets: if rd not in other.rdatasets: return False for rd in other.rdatasets: if rd not in self.rdatasets: return False return True def __ne__(self, other): return not self.__eq__(other) def __len__(self): return len(self.rdatasets) def __iter__(self): return iter(self.rdatasets) def find_rdataset(self, rdclass, rdtype, covers=dns.rdatatype.NONE, create=False): """Find an rdataset matching the specified properties in the current node. @param rdclass: The class of the rdataset @type rdclass: int @param rdtype: The type of the rdataset @type rdtype: int @param covers: The covered type. Usually this value is dns.rdatatype.NONE, but if the rdtype is dns.rdatatype.SIG or dns.rdatatype.RRSIG, then the covers value will be the rdata type the SIG/RRSIG covers. The library treats the SIG and RRSIG types as if they were a family of types, e.g. RRSIG(A), RRSIG(NS), RRSIG(SOA). This makes RRSIGs much easier to work with than if RRSIGs covering different rdata types were aggregated into a single RRSIG rdataset. @type covers: int @param create: If True, create the rdataset if it is not found. @type create: bool @raises KeyError: An rdataset of the desired type and class does not exist and I{create} is not True. @rtype: dns.rdataset.Rdataset object """ for rds in self.rdatasets: if rds.match(rdclass, rdtype, covers): return rds if not create: raise KeyError rds = dns.rdataset.Rdataset(rdclass, rdtype) self.rdatasets.append(rds) return rds def get_rdataset(self, rdclass, rdtype, covers=dns.rdatatype.NONE, create=False): """Get an rdataset matching the specified properties in the current node. None is returned if an rdataset of the specified type and class does not exist and I{create} is not True. @param rdclass: The class of the rdataset @type rdclass: int @param rdtype: The type of the rdataset @type rdtype: int @param covers: The covered type. @type covers: int @param create: If True, create the rdataset if it is not found. @type create: bool @rtype: dns.rdataset.Rdataset object or None """ try: rds = self.find_rdataset(rdclass, rdtype, covers, create) except KeyError: rds = None return rds def delete_rdataset(self, rdclass, rdtype, covers=dns.rdatatype.NONE): """Delete the rdataset matching the specified properties in the current node. If a matching rdataset does not exist, it is not an error. @param rdclass: The class of the rdataset @type rdclass: int @param rdtype: The type of the rdataset @type rdtype: int @param covers: The covered type. @type covers: int """ rds = self.get_rdataset(rdclass, rdtype, covers) if rds is not None: self.rdatasets.remove(rds) def replace_rdataset(self, replacement): """Replace an rdataset. It is not an error if there is no rdataset matching I{replacement}. Ownership of the I{replacement} object is transferred to the node; in other words, this method does not store a copy of I{replacement} at the node, it stores I{replacement} itself. """ if not isinstance(replacement, dns.rdataset.Rdataset): raise ValueError('replacement is not an rdataset') self.delete_rdataset(replacement.rdclass, replacement.rdtype, replacement.covers) self.rdatasets.append(replacement) PK g\K炕: : rdata.pynu [ # Copyright (C) 2001-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. """DNS rdata. @var _rdata_modules: A dictionary mapping a (rdclass, rdtype) tuple to the module which implements that type. @type _rdata_modules: dict @var _module_prefix: The prefix to use when forming modules names. The default is 'dns.rdtypes'. Changing this value will break the library. @type _module_prefix: string @var _hex_chunk: At most this many octets that will be represented in each chunk of hexstring that _hexify() produces before whitespace occurs. @type _hex_chunk: int""" from io import BytesIO import base64 import binascii import dns.exception import dns.name import dns.rdataclass import dns.rdatatype import dns.tokenizer import dns.wiredata from ._compat import xrange, string_types, text_type _hex_chunksize = 32 def _hexify(data, chunksize=_hex_chunksize): """Convert a binary string into its hex encoding, broken up into chunks of I{chunksize} characters separated by a space. @param data: the binary string @type data: string @param chunksize: the chunk size. Default is L{dns.rdata._hex_chunksize} @rtype: string """ line = binascii.hexlify(data) return b' '.join([line[i:i + chunksize] for i in range(0, len(line), chunksize)]).decode() _base64_chunksize = 32 def _base64ify(data, chunksize=_base64_chunksize): """Convert a binary string into its base64 encoding, broken up into chunks of I{chunksize} characters separated by a space. @param data: the binary string @type data: string @param chunksize: the chunk size. Default is L{dns.rdata._base64_chunksize} @rtype: string """ line = base64.b64encode(data) return b' '.join([line[i:i + chunksize] for i in range(0, len(line), chunksize)]).decode() __escaped = bytearray(b'"\\') def _escapify(qstring): """Escape the characters in a quoted string which need it. @param qstring: the string @type qstring: string @returns: the escaped string @rtype: string """ if isinstance(qstring, text_type): qstring = qstring.encode() if not isinstance(qstring, bytearray): qstring = bytearray(qstring) text = '' for c in qstring: if c in __escaped: text += '\\' + chr(c) elif c >= 0x20 and c < 0x7F: text += chr(c) else: text += '\\%03d' % c return text def _truncate_bitmap(what): """Determine the index of greatest byte that isn't all zeros, and return the bitmap that contains all the bytes less than that index. @param what: a string of octets representing a bitmap. @type what: string @rtype: string """ for i in xrange(len(what) - 1, -1, -1): if what[i] != 0: return what[0: i + 1] return what[0:1] class Rdata(object): """Base class for all DNS rdata types. """ __slots__ = ['rdclass', 'rdtype'] def __init__(self, rdclass, rdtype): """Initialize an rdata. @param rdclass: The rdata class @type rdclass: int @param rdtype: The rdata type @type rdtype: int """ self.rdclass = rdclass self.rdtype = rdtype def covers(self): """DNS SIG/RRSIG rdatas apply to a specific type; this type is returned by the covers() function. If the rdata type is not SIG or RRSIG, dns.rdatatype.NONE is returned. This is useful when creating rdatasets, allowing the rdataset to contain only RRSIGs of a particular type, e.g. RRSIG(NS). @rtype: int """ return dns.rdatatype.NONE def extended_rdatatype(self): """Return a 32-bit type value, the least significant 16 bits of which are the ordinary DNS type, and the upper 16 bits of which are the "covered" type, if any. @rtype: int """ return self.covers() << 16 | self.rdtype def to_text(self, origin=None, relativize=True, **kw): """Convert an rdata to text format. @rtype: string """ raise NotImplementedError def to_wire(self, file, compress=None, origin=None): """Convert an rdata to wire format. @rtype: string """ raise NotImplementedError def to_digestable(self, origin=None): """Convert rdata to a format suitable for digesting in hashes. This is also the DNSSEC canonical form.""" f = BytesIO() self.to_wire(f, None, origin) return f.getvalue() def validate(self): """Check that the current contents of the rdata's fields are valid. If you change an rdata by assigning to its fields, it is a good idea to call validate() when you are done making changes. """ dns.rdata.from_text(self.rdclass, self.rdtype, self.to_text()) def __repr__(self): covers = self.covers() if covers == dns.rdatatype.NONE: ctext = '' else: ctext = '(' + dns.rdatatype.to_text(covers) + ')' return '<DNS ' + dns.rdataclass.to_text(self.rdclass) + ' ' + \ dns.rdatatype.to_text(self.rdtype) + ctext + ' rdata: ' + \ str(self) + '>' def __str__(self): return self.to_text() def _cmp(self, other): """Compare an rdata with another rdata of the same rdtype and rdclass. Return < 0 if self < other in the DNSSEC ordering, 0 if self == other, and > 0 if self > other. """ our = self.to_digestable(dns.name.root) their = other.to_digestable(dns.name.root) if our == their: return 0 if our > their: return 1 return -1 def __eq__(self, other): if not isinstance(other, Rdata): return False if self.rdclass != other.rdclass or self.rdtype != other.rdtype: return False return self._cmp(other) == 0 def __ne__(self, other): if not isinstance(other, Rdata): return True if self.rdclass != other.rdclass or self.rdtype != other.rdtype: return True return self._cmp(other) != 0 def __lt__(self, other): if not isinstance(other, Rdata) or \ self.rdclass != other.rdclass or self.rdtype != other.rdtype: return NotImplemented return self._cmp(other) < 0 def __le__(self, other): if not isinstance(other, Rdata) or \ self.rdclass != other.rdclass or self.rdtype != other.rdtype: return NotImplemented return self._cmp(other) <= 0 def __ge__(self, other): if not isinstance(other, Rdata) or \ self.rdclass != other.rdclass or self.rdtype != other.rdtype: return NotImplemented return self._cmp(other) >= 0 def __gt__(self, other): if not isinstance(other, Rdata) or \ self.rdclass != other.rdclass or self.rdtype != other.rdtype: return NotImplemented return self._cmp(other) > 0 def __hash__(self): return hash(self.to_digestable(dns.name.root)) @classmethod def from_text(cls, rdclass, rdtype, tok, origin=None, relativize=True): """Build an rdata object from text format. @param rdclass: The rdata class @type rdclass: int @param rdtype: The rdata type @type rdtype: int @param tok: The tokenizer @type tok: dns.tokenizer.Tokenizer @param origin: The origin to use for relative names @type origin: dns.name.Name @param relativize: should names be relativized? @type relativize: bool @rtype: dns.rdata.Rdata instance """ raise NotImplementedError @classmethod def from_wire(cls, rdclass, rdtype, wire, current, rdlen, origin=None): """Build an rdata object from wire format @param rdclass: The rdata class @type rdclass: int @param rdtype: The rdata type @type rdtype: int @param wire: The wire-format message @type wire: string @param current: The offset in wire of the beginning of the rdata. @type current: int @param rdlen: The length of the wire-format rdata @type rdlen: int @param origin: The origin to use for relative names @type origin: dns.name.Name @rtype: dns.rdata.Rdata instance """ raise NotImplementedError def choose_relativity(self, origin=None, relativize=True): """Convert any domain names in the rdata to the specified relativization. """ pass class GenericRdata(Rdata): """Generate Rdata Class This class is used for rdata types for which we have no better implementation. It implements the DNS "unknown RRs" scheme. """ __slots__ = ['data'] def __init__(self, rdclass, rdtype, data): super(GenericRdata, self).__init__(rdclass, rdtype) self.data = data def to_text(self, origin=None, relativize=True, **kw): return r'\# %d ' % len(self.data) + _hexify(self.data) @classmethod def from_text(cls, rdclass, rdtype, tok, origin=None, relativize=True): token = tok.get() if not token.is_identifier() or token.value != '\#': raise dns.exception.SyntaxError( r'generic rdata does not start with \#') length = tok.get_int() chunks = [] while 1: token = tok.get() if token.is_eol_or_eof(): break chunks.append(token.value.encode()) hex = b''.join(chunks) data = binascii.unhexlify(hex) if len(data) != length: raise dns.exception.SyntaxError( 'generic rdata hex data has wrong length') return cls(rdclass, rdtype, data) def to_wire(self, file, compress=None, origin=None): file.write(self.data) @classmethod def from_wire(cls, rdclass, rdtype, wire, current, rdlen, origin=None): return cls(rdclass, rdtype, wire[current: current + rdlen]) _rdata_modules = {} _module_prefix = 'dns.rdtypes' def get_rdata_class(rdclass, rdtype): def import_module(name): mod = __import__(name) components = name.split('.') for comp in components[1:]: mod = getattr(mod, comp) return mod mod = _rdata_modules.get((rdclass, rdtype)) rdclass_text = dns.rdataclass.to_text(rdclass) rdtype_text = dns.rdatatype.to_text(rdtype) rdtype_text = rdtype_text.replace('-', '_') if not mod: mod = _rdata_modules.get((dns.rdatatype.ANY, rdtype)) if not mod: try: mod = import_module('.'.join([_module_prefix, rdclass_text, rdtype_text])) _rdata_modules[(rdclass, rdtype)] = mod except ImportError: try: mod = import_module('.'.join([_module_prefix, 'ANY', rdtype_text])) _rdata_modules[(dns.rdataclass.ANY, rdtype)] = mod except ImportError: mod = None if mod: cls = getattr(mod, rdtype_text) else: cls = GenericRdata return cls def from_text(rdclass, rdtype, tok, origin=None, relativize=True): """Build an rdata object from text format. This function attempts to dynamically load a class which implements the specified rdata class and type. If there is no class-and-type-specific implementation, the GenericRdata class is used. Once a class is chosen, its from_text() class method is called with the parameters to this function. If I{tok} is a string, then a tokenizer is created and the string is used as its input. @param rdclass: The rdata class @type rdclass: int @param rdtype: The rdata type @type rdtype: int @param tok: The tokenizer or input text @type tok: dns.tokenizer.Tokenizer or string @param origin: The origin to use for relative names @type origin: dns.name.Name @param relativize: Should names be relativized? @type relativize: bool @rtype: dns.rdata.Rdata instance""" if isinstance(tok, string_types): tok = dns.tokenizer.Tokenizer(tok) cls = get_rdata_class(rdclass, rdtype) if cls != GenericRdata: # peek at first token token = tok.get() tok.unget(token) if token.is_identifier() and \ token.value == r'\#': # # Known type using the generic syntax. Extract the # wire form from the generic syntax, and then run # from_wire on it. # rdata = GenericRdata.from_text(rdclass, rdtype, tok, origin, relativize) return from_wire(rdclass, rdtype, rdata.data, 0, len(rdata.data), origin) return cls.from_text(rdclass, rdtype, tok, origin, relativize) def from_wire(rdclass, rdtype, wire, current, rdlen, origin=None): """Build an rdata object from wire format This function attempts to dynamically load a class which implements the specified rdata class and type. If there is no class-and-type-specific implementation, the GenericRdata class is used. Once a class is chosen, its from_wire() class method is called with the parameters to this function. @param rdclass: The rdata class @type rdclass: int @param rdtype: The rdata type @type rdtype: int @param wire: The wire-format message @type wire: string @param current: The offset in wire of the beginning of the rdata. @type current: int @param rdlen: The length of the wire-format rdata @type rdlen: int @param origin: The origin to use for relative names @type origin: dns.name.Name @rtype: dns.rdata.Rdata instance""" wire = dns.wiredata.maybe_wrap(wire) cls = get_rdata_class(rdclass, rdtype) return cls.from_wire(rdclass, rdtype, wire, current, rdlen, origin) PK g\ rdataclass.pynu [ # Copyright (C) 2001-2007, 2009-2011 Nominum, Inc. # # Permission to use, copy, modify, and distribute this software and its # documentation for any purpose with or without fee is hereby granted, # provided that the above copyright notice and this permission notice # appear in all copies. # # THE SOFTWARE IS PROVIDED "AS IS" AND NOMINUM DISCLAIMS ALL WARRANTIES # WITH REGARD TO THIS SOFTWARE INCLUDING ALL IMPLIED WARRANTIES OF # MERCHANTABILITY AND FITNESS. IN NO EVENT SHALL NOMINUM BE LIABLE FOR # ANY SPECIAL, DIRECT, INDIRECT, OR CONSEQUENTIAL DAMAGES OR ANY DAMAGES # WHATSOEVER RESULTING FROM LOSS OF USE, DATA OR PROFITS, WHETHER IN AN # ACTION OF CONTRACT, NEGLIGENCE OR OTHER TORTIOUS ACTION, ARISING OUT # OF OR IN CONNECTION WITH THE USE OR PERFORMANCE OF THIS SOFTWARE. """DNS Rdata Classes. @var _by_text: The rdata class textual name to value mapping @type _by_text: dict @var _by_value: The rdata class value to textual name mapping @type _by_value: dict @var _metaclasses: If an rdataclass is a metaclass, there will be a mapping whose key is the rdatatype value and whose value is True in this dictionary. @type _metaclasses: dict""" import re import dns.exception RESERVED0 = 0 IN = 1 CH = 3 HS = 4 NONE = 254 ANY = 255 _by_text = { 'RESERVED0': RESERVED0, 'IN': IN, 'CH': CH, 'HS': HS, 'NONE': NONE, 'ANY': ANY } # We construct the inverse mapping programmatically to ensure that we # cannot make any mistakes (e.g. omissions, cut-and-paste errors) that # would cause the mapping not to be true inverse. _by_value = dict((y, x) for x, y in _by_text.items()) # Now that we've built the inverse map, we can add class aliases to # the _by_text mapping. _by_text.update({ 'INTERNET': IN, 'CHAOS': CH, 'HESIOD': HS }) _metaclasses = { NONE: True, ANY: True } _unknown_class_pattern = re.compile('CLASS([0-9]+)$', re.I) class UnknownRdataclass(dns.exception.DNSException): """A DNS class is unknown.""" def from_text(text): """Convert text into a DNS rdata class value. @param text: the text @type text: string @rtype: int @raises dns.rdataclass.UnknownRdataclass: the class is unknown @raises ValueError: the rdata class value is not >= 0 and <= 65535 """ value = _by_text.get(text.upper()) if value is None: match = _unknown_class_pattern.match(text) if match is None: raise UnknownRdataclass value = int(match.group(1)) if value < 0 or value > 65535: raise ValueError("class must be between >= 0 and <= 65535") return value def to_text(value): """Convert a DNS rdata class to text. @param value: the rdata class value @type value: int @rtype: string @raises ValueError: the rdata class value is not >= 0 and <= 65535 """ if value < 0 or value > 65535: raise ValueError("class must be between >= 0 and <= 65535") text = _by_value.get(value) if text is None: text = 'CLASS' + repr(value) return text def is_metaclass(rdclass): """True if the class is a metaclass. @param rdclass: the rdata class @type rdclass: int @rtype: bool""" if rdclass in _metaclasses: return True return False PK g\ grange.pynu [ PK g\`o L L hash.pynu [ PK g\2Y9 q inet.pynu [ PK g\E!o& & R tsig.pynu [ PK g\ӉG G 7 tokenizer.pynu [ PK g\%. . t renderer.pynu [ PK g\EG B exception.pynu [ PK g\A ' __pycache__/opcode.cpython-36.opt-1.pycnu [ PK g\b? & __pycache__/tsigkeyring.cpython-36.pycnu [ PK g\= " ^ __pycache__/version.cpython-36.pycnu [ PK g\J,* * ! r __pycache__/dnssec.cpython-36.pycnu [ PK g\i i f __pycache__/name.cpython-36.pycnu [ PK g\pJն ! d __pycache__/update.cpython-36.pycnu [ PK g\z} & & ) __pycache__/renderer.cpython-36.opt-1.pycnu [ PK g\" __pycache__/inet.cpython-36.pycnu [ PK g\pp $ r __pycache__/rdatatype.cpython-36.pycnu [ PK g\-^L % [ __pycache__/hash.cpython-36.opt-1.pycnu [ PK g\VJ8 8 * __pycache__/tokenizer.cpython-36.opt-1.pycnu [ PK g\ % __pycache__/rdataclass.cpython-36.pycnu [ PK g\5 n n " __pycache__/message.cpython-36.pycnu [ PK g\` 7 7 % q __pycache__/edns.cpython-36.opt-1.pycnu [ PK g\|g g % __pycache__/e164.cpython-36.opt-1.pycnu [ PK g\i i % __pycache__/name.cpython-36.opt-1.pycnu [ PK g\Yҹu u % __pycache__/zone.cpython-36.opt-1.pycnu [ PK g\Z ! __pycache__/grange.cpython-36.pycnu [ PK g\d rN N % __pycache__/ipv4.cpython-36.pycnu [ PK g\JaA A __pycache__/tsig.cpython-36.pycnu [ PK g\])z z R __pycache__/flags.cpython-36.pycnu [ PK g\{_ $ __pycache__/set.cpython-36.opt-1.pycnu [ PK g\f5 " O __pycache__/entropy.cpython-36.pycnu [ PK g\8Yw w & t __pycache__/rrset.cpython-36.opt-1.pycnu [ PK g\VJ8 8 $ A __pycache__/tokenizer.cpython-36.pycnu [ PK g\! ! , @) __pycache__/reversename.cpython-36.opt-1.pycnu [ PK g\=*ᴈ ' 3 __pycache__/grange.cpython-36.opt-1.pycnu [ PK g\ + 7 __pycache__/rdataclass.cpython-36.opt-1.pycnu [ PK g\! ! & A __pycache__/reversename.cpython-36.pycnu [ PK g\|g g :L __pycache__/e164.cpython-36.pycnu [ PK g\k' ' ) V __pycache__/namedict.cpython-36.opt-1.pycnu [ PK g\pp * pb __pycache__/rdatatype.cpython-36.opt-1.pycnu [ PK g\5 n n ( _t __pycache__/message.cpython-36.opt-1.pycnu [ PK g\M ) % __pycache__/resolver.cpython-36.opt-1.pycnu [ PK g\JaA A % > __pycache__/tsig.cpython-36.opt-1.pycnu [ PK g\ȟ Ԙ __pycache__/ipv6.cpython-36.pycnu [ PK g\8Yw w Ϥ __pycache__/rrset.cpython-36.pycnu [ PK g\0 __pycache__/node.cpython-36.pycnu [ PK g\])z z & __pycache__/flags.cpython-36.opt-1.pycnu [ PK g\{_ S __pycache__/set.cpython-36.pycnu [ PK g\bCI " __pycache__/_compat.cpython-36.pycnu [ PK g\M( ( $ __pycache__/ttl.cpython-36.opt-1.pycnu [ PK g\]5 5 & a __pycache__/query.cpython-36.opt-1.pycnu [ PK g\0q q * k8 __pycache__/exception.cpython-36.opt-1.pycnu [ PK g\A ! 6G __pycache__/opcode.cpython-36.pycnu [ PK g\YZ 8 8 O __pycache__/rdata.cpython-36.pycnu [ PK g\` 7 7 __pycache__/edns.cpython-36.pycnu [ PK g\k' ' # r __pycache__/namedict.cpython-36.pycnu [ PK g\o o # __pycache__/wiredata.cpython-36.pycnu [ PK g\0 % P __pycache__/node.cpython-36.opt-1.pycnu [ PK g\M # C __pycache__/resolver.cpython-36.pycnu [ PK g\֙O'% '% ) VP __pycache__/rdataset.cpython-36.opt-1.pycnu [ PK g\ȟ % u __pycache__/ipv6.cpython-36.opt-1.pycnu [ PK g\d rN N % ׁ __pycache__/ipv4.cpython-36.opt-1.pycnu [ PK g\_DBI I ) z __pycache__/__init__.cpython-36.opt-1.pycnu [ PK g\i?N% N% # __pycache__/rdataset.cpython-36.pycnu [ PK g\-^L __pycache__/hash.cpython-36.pycnu [ PK g\pJն ' __pycache__/update.cpython-36.opt-1.pycnu [ PK g\zu-\* \* ' __pycache__/dnssec.cpython-36.opt-1.pycnu [ PK g\]5 5 __pycache__/query.cpython-36.pycnu [ PK g\Yҹu u . __pycache__/zone.cpython-36.pycnu [ PK g\f5 ( __pycache__/entropy.cpython-36.opt-1.pycnu [ PK g\: & ޱ __pycache__/rcode.cpython-36.opt-1.pycnu [ PK g\雅Xc& c& # __pycache__/renderer.cpython-36.pycnu [ PK g\YZ 8 8 & __pycache__/rdata.cpython-36.opt-1.pycnu [ PK g\o o ) __pycache__/wiredata.cpython-36.opt-1.pycnu [ PK g\= ( t$ __pycache__/version.cpython-36.opt-1.pycnu [ PK g\_DBI I # & __pycache__/__init__.cpython-36.pycnu [ PK g\M( ( *) __pycache__/ttl.cpython-36.pycnu [ PK g\" % . __pycache__/inet.cpython-36.opt-1.pycnu [ PK g\: 8 __pycache__/rcode.cpython-36.pycnu [ PK g\şD D $ B __pycache__/exception.cpython-36.pycnu [ PK g\b? , Q __pycache__/tsigkeyring.cpython-36.opt-1.pycnu [ PK g\bCI ( V __pycache__/_compat.cpython-36.opt-1.pycnu [ PK g\V [ ipv6.pynu [ PK g\ jp opcode.pynu [ PK g\ji] ] z namedict.pynu [ PK g\5t % wiredata.pynu [ PK g\Qy y message.pynu [ PK g\^Is @ tsigkeyring.pynu [ PK g\קq q G entropy.pynu [ PK g\X2 XY reversename.pynu [ PK g\ ' ' f update.pynu [ PK g\7Dr r ڍ name.pynu [ PK g\ų4h h flags.pynu [ PK g\25 # # set.pynu [ PK g\Cyx ) edns.pynu [ PK g\O R; ttl.pynu [ PK g\;J sD rdtypes/IN/NSAP.pynu [ PK g\/"t t L rdtypes/IN/APL.pynu [ PK g\0 } } a rdtypes/IN/NSAP_PTR.pynu [ PK g\21 1 Le rdtypes/IN/IPSECKEY.pynu [ PK g\2 { rdtypes/IN/SRV.pynu [ PK g\ qQ rdtypes/IN/WKS.pynu [ PK g\ / rdtypes/IN/__pycache__/SRV.cpython-36.opt-1.pycnu [ PK g\= 1 h rdtypes/IN/__pycache__/DHCID.cpython-36.opt-1.pycnu [ PK g\\m9Mr r 4 Z rdtypes/IN/__pycache__/NSAP_PTR.cpython-36.opt-1.pycnu [ PK g\g ) 0 rdtypes/IN/__pycache__/WKS.cpython-36.pycnu [ PK g\"ݯ! ! ( G rdtypes/IN/__pycache__/PX.cpython-36.pycnu [ PK g\\m9Mr r . rdtypes/IN/__pycache__/NSAP_PTR.cpython-36.pycnu [ PK g\٣ * rdtypes/IN/__pycache__/AAAA.cpython-36.pycnu [ PK g\g * rdtypes/IN/__pycache__/NSAP.cpython-36.pycnu [ PK g\6Pb 4 rdtypes/IN/__pycache__/IPSECKEY.cpython-36.opt-1.pycnu [ PK g\ - rdtypes/IN/__pycache__/A.cpython-36.opt-1.pycnu [ PK g\= + rdtypes/IN/__pycache__/DHCID.cpython-36.pycnu [ PK g\" ) rdtypes/IN/__pycache__/APL.cpython-36.pycnu [ PK g\6Pb . rdtypes/IN/__pycache__/IPSECKEY.cpython-36.pycnu [ PK g\ ) z rdtypes/IN/__pycache__/SRV.cpython-36.pycnu [ PK g\"ݯ! ! . rdtypes/IN/__pycache__/PX.cpython-36.opt-1.pycnu [ PK g\T` ` ( E rdtypes/IN/__pycache__/KX.cpython-36.pycnu [ PK g\S 4 rdtypes/IN/__pycache__/__init__.cpython-36.opt-1.pycnu [ PK g\g 0 q rdtypes/IN/__pycache__/NSAP.cpython-36.opt-1.pycnu [ PK g\ / # rdtypes/IN/__pycache__/APL.cpython-36.opt-1.pycnu [ PK g\ + 2 rdtypes/IN/__pycache__/NAPTR.cpython-36.pycnu [ PK g\T` ` . ? rdtypes/IN/__pycache__/KX.cpython-36.opt-1.pycnu [ PK g\٣ 0 A rdtypes/IN/__pycache__/AAAA.cpython-36.opt-1.pycnu [ PK g\rO 1 !H rdtypes/IN/__pycache__/NAPTR.cpython-36.opt-1.pycnu [ PK g\S . KU rdtypes/IN/__pycache__/__init__.cpython-36.pycnu [ PK g\ ' V rdtypes/IN/__pycache__/A.cpython-36.pycnu [ PK g\g / ] rdtypes/IN/__pycache__/WKS.cpython-36.opt-1.pycnu [ PK g\ !h rdtypes/IN/DHCID.pynu [ PK g\7q q Gp rdtypes/IN/KX.pynu [ PK g\4= = s rdtypes/IN/A.pynu [ PK g\mB B t{ rdtypes/IN/PX.pynu [ PK g\Wv v rdtypes/IN/NAPTR.pynu [ PK g\RJ6r rdtypes/IN/__init__.pynu [ PK g\ rdtypes/IN/AAAA.pynu [ PK g\о rdtypes/ANY/DNSKEY.pynu [ PK g\GR R Ӫ rdtypes/ANY/NSEC.pynu [ PK g\ h rdtypes/ANY/RP.pynu [ PK g\? d d rdtypes/ANY/EUI48.pynu [ PK g\3,n n O rdtypes/ANY/EUI64.pynu [ PK g\7R R rdtypes/ANY/URI.pynu [ PK g\ rdtypes/ANY/CDNSKEY.pynu [ PK g\`0o o rdtypes/ANY/CERT.pynu [ PK g\c# rdtypes/ANY/TLSA.pynu [ PK g\j/jk k * ^ rdtypes/ANY/__pycache__/LOC.cpython-36.pycnu [ PK g\ޑ j 1 # rdtypes/ANY/__pycache__/ISDN.cpython-36.opt-1.pycnu [ PK g\[ [QX X / 1( rdtypes/ANY/__pycache__/NS.cpython-36.opt-1.pycnu [ PK g\w- , ) rdtypes/ANY/__pycache__/EUI48.cpython-36.pycnu [ PK g\u[ [ , V, rdtypes/ANY/__pycache__/SSHFP.cpython-36.pycnu [ PK g\oDB 2 5 rdtypes/ANY/__pycache__/HINFO.cpython-36.opt-1.pycnu [ PK g\!F0 3 8= rdtypes/ANY/__pycache__/DNSKEY.cpython-36.opt-1.pycnu [ PK g\ 1 n? rdtypes/ANY/__pycache__/TLSA.cpython-36.opt-1.pycnu [ PK g\j+ 1 H rdtypes/ANY/__pycache__/CERT.cpython-36.opt-1.pycnu [ PK g\ 0 T rdtypes/ANY/__pycache__/X25.cpython-36.opt-1.pycnu [ PK g\T/[ [ 0 [ rdtypes/ANY/__pycache__/CDS.cpython-36.opt-1.pycnu [ PK g\ , ] rdtypes/ANY/__pycache__/EUI64.cpython-36.pycnu [ PK g\ { 2 ` rdtypes/ANY/__pycache__/NSEC3.cpython-36.opt-1.pycnu [ PK g\!F0 - Tr rdtypes/ANY/__pycache__/DNSKEY.cpython-36.pycnu [ PK g\?rj j / t rdtypes/ANY/__pycache__/RT.cpython-36.opt-1.pycnu [ PK g\[ [QX X ) Mv rdtypes/ANY/__pycache__/NS.cpython-36.pycnu [ PK g\ . w rdtypes/ANY/__pycache__/CDNSKEY.cpython-36.pycnu [ PK g\u[ [ 2 2z rdtypes/ANY/__pycache__/SSHFP.cpython-36.opt-1.pycnu [ PK g\!s 2 rdtypes/ANY/__pycache__/DNAME.cpython-36.opt-1.pycnu [ PK g\UXTX X ) T rdtypes/ANY/__pycache__/DS.cpython-36.pycnu [ PK g\ + rdtypes/ANY/__pycache__/TLSA.cpython-36.pycnu [ PK g\> * > rdtypes/ANY/__pycache__/AVC.cpython-36.pycnu [ PK g\_ _ 2 N rdtypes/ANY/__pycache__/RRSIG.cpython-36.opt-1.pycnu [ PK g\+( ( * rdtypes/ANY/__pycache__/CAA.cpython-36.pycnu [ PK g\M ) rdtypes/ANY/__pycache__/RP.cpython-36.pycnu [ PK g\r 1 rdtypes/ANY/__pycache__/NSEC.cpython-36.opt-1.pycnu [ PK g\UXTX X / rdtypes/ANY/__pycache__/DS.cpython-36.opt-1.pycnu [ PK g\M / rdtypes/ANY/__pycache__/RP.cpython-36.opt-1.pycnu [ PK g\w- 2 rdtypes/ANY/__pycache__/EUI48.cpython-36.opt-1.pycnu [ PK g\.M * | rdtypes/ANY/__pycache__/X25.cpython-36.pycnu [ PK g\\m * rdtypes/ANY/__pycache__/HIP.cpython-36.pycnu [ PK g\ ab4[ [ * rdtypes/ANY/__pycache__/DLV.cpython-36.pycnu [ PK g\?[' 0 K rdtypes/ANY/__pycache__/URI.cpython-36.opt-1.pycnu [ PK g\_ _ , ~ rdtypes/ANY/__pycache__/RRSIG.cpython-36.pycnu [ PK g\#c . . 2 9 rdtypes/ANY/__pycache__/CNAME.cpython-36.opt-1.pycnu [ PK g\r + rdtypes/ANY/__pycache__/NSEC.cpython-36.pycnu [ PK g\Ip p , rdtypes/ANY/__pycache__/CSYNC.cpython-36.pycnu [ PK g\ݹSX X / rdtypes/ANY/__pycache__/MX.cpython-36.opt-1.pycnu [ PK g\?[' * P rdtypes/ANY/__pycache__/URI.cpython-36.pycnu [ PK g\T/[ [ * }( rdtypes/ANY/__pycache__/CDS.cpython-36.pycnu [ PK g\?rj j ) 2* rdtypes/ANY/__pycache__/RT.cpython-36.pycnu [ PK g\5r r 0 + rdtypes/ANY/__pycache__/SPF.cpython-36.opt-1.pycnu [ PK g\eQ? ? 2 - rdtypes/ANY/__pycache__/AFSDB.cpython-36.opt-1.pycnu [ PK g\ݹSX X ) h2 rdtypes/ANY/__pycache__/MX.cpython-36.pycnu [ PK g\\m 0 4 rdtypes/ANY/__pycache__/HIP.cpython-36.opt-1.pycnu [ PK g\j/jk k 0 A rdtypes/ANY/__pycache__/LOC.cpython-36.opt-1.pycnu [ PK g\;[ [ 0 a rdtypes/ANY/__pycache__/PTR.cpython-36.opt-1.pycnu [ PK g\> 0 c rdtypes/ANY/__pycache__/AVC.cpython-36.opt-1.pycnu [ PK g\}< < + e rdtypes/ANY/__pycache__/GPOS.cpython-36.pycnu [ PK g\&c 1 Hv rdtypes/ANY/__pycache__/GPOS.cpython-36.opt-1.pycnu [ PK g\j+ + rdtypes/ANY/__pycache__/CERT.cpython-36.pycnu [ PK g\ǃ^ ^ 0 ߒ rdtypes/ANY/__pycache__/TXT.cpython-36.opt-1.pycnu [ PK g\ 4 rdtypes/ANY/__pycache__/CDNSKEY.cpython-36.opt-1.pycnu [ PK g\) ) 1 ז rdtypes/ANY/__pycache__/NSEC3PARAM.cpython-36.pycnu [ PK g\UΔ 5 a rdtypes/ANY/__pycache__/__init__.cpython-36.opt-1.pycnu [ PK g\ ab4[ [ 0 rdtypes/ANY/__pycache__/DLV.cpython-36.opt-1.pycnu [ PK g\ 2 i rdtypes/ANY/__pycache__/EUI64.cpython-36.opt-1.pycnu [ PK g\^ 0 ݦ rdtypes/ANY/__pycache__/CAA.cpython-36.opt-1.pycnu [ PK g\5r r * B rdtypes/ANY/__pycache__/SPF.cpython-36.pycnu [ PK g\h 0 rdtypes/ANY/__pycache__/SOA.cpython-36.opt-1.pycnu [ PK g\, + N rdtypes/ANY/__pycache__/ISDN.cpython-36.pycnu [ PK g\!s , rdtypes/ANY/__pycache__/DNAME.cpython-36.pycnu [ PK g\Ip p 2 rdtypes/ANY/__pycache__/CSYNC.cpython-36.opt-1.pycnu [ PK g\UΔ / rdtypes/ANY/__pycache__/__init__.cpython-36.pycnu [ PK g\h * rdtypes/ANY/__pycache__/SOA.cpython-36.pycnu [ PK g\) ) 7 9 rdtypes/ANY/__pycache__/NSEC3PARAM.cpython-36.opt-1.pycnu [ PK g\#c . . , rdtypes/ANY/__pycache__/CNAME.cpython-36.pycnu [ PK g\ { , S rdtypes/ANY/__pycache__/NSEC3.cpython-36.pycnu [ PK g\eQ? ? , rdtypes/ANY/__pycache__/AFSDB.cpython-36.pycnu [ PK g\ǃ^ ^ * rdtypes/ANY/__pycache__/TXT.cpython-36.pycnu [ PK g\r , rdtypes/ANY/__pycache__/HINFO.cpython-36.pycnu [ PK g\;[ [ * . rdtypes/ANY/__pycache__/PTR.cpython-36.pycnu [ PK g\ig rdtypes/ANY/SOA.pynu [ PK g\ 2/ / & rdtypes/ANY/LOC.pynu [ PK g\ϝs8 8 V rdtypes/ANY/AFSDB.pynu [ PK g\ZS0 0 s^ rdtypes/ANY/HIP.pynu [ PK g\° n rdtypes/ANY/SSHFP.pynu [ PK g\n{ { 5z rdtypes/ANY/RT.pynu [ PK g\CNcG G } rdtypes/ANY/X25.pynu [ PK g\JBi i z rdtypes/ANY/DS.pynu [ PK g\[Rei i $ rdtypes/ANY/NS.pynu [ PK g\0 rdtypes/ANY/__init__.pynu [ PK g\U& ڒ rdtypes/ANY/SPF.pynu [ PK g\-k k rdtypes/ANY/CDS.pynu [ PK g\k9 L rdtypes/ANY/NSEC3PARAM.pynu [ PK g\5_W5 rdtypes/ANY/AVC.pynu [ PK g\[$$ $ rdtypes/ANY/CSYNC.pynu [ PK g\EAVk k rdtypes/ANY/PTR.pynu [ PK g\Bd rdtypes/ANY/DNAME.pynu [ PK g\y1s rdtypes/ANY/GPOS.pynu [ PK g\,i i rdtypes/ANY/MX.pynu [ PK g\&͡ rdtypes/ANY/NSEC3.pynu [ PK g\` ` rdtypes/ANY/DLV.pynu [ PK g\Cn n @ rdtypes/ANY/TXT.pynu [ PK g\x > > rdtypes/ANY/CAA.pynu [ PK g\o:Ri i p rdtypes/ANY/HINFO.pynu [ PK g\Qx rdtypes/ANY/ISDN.pynu [ PK g\o( < < %# rdtypes/ANY/CNAME.pynu [ PK g\X ' rdtypes/ANY/RRSIG.pynu [ PK g\ > rdtypes/euibase.pynu [ PK g\v~u u ) #I rdtypes/__pycache__/nsbase.cpython-36.pycnu [ PK g\ac c * S rdtypes/__pycache__/euibase.cpython-36.pycnu [ PK g\V5 5 - \ rdtypes/__pycache__/dnskeybase.cpython-36.pycnu [ PK g\ac c 0 @k rdtypes/__pycache__/euibase.cpython-36.opt-1.pycnu [ PK g\C / t rdtypes/__pycache__/mxbase.cpython-36.opt-1.pycnu [ PK g\E / rdtypes/__pycache__/dsbase.cpython-36.opt-1.pycnu [ PK g\C ) x rdtypes/__pycache__/mxbase.cpython-36.pycnu [ PK g\V5 5 3 h rdtypes/__pycache__/dnskeybase.cpython-36.opt-1.pycnu [ PK g\v~u u / rdtypes/__pycache__/nsbase.cpython-36.opt-1.pycnu [ PK g\B1 * Բ rdtypes/__pycache__/txtbase.cpython-36.pycnu [ PK g\t 0 J rdtypes/__pycache__/txtbase.cpython-36.opt-1.pycnu [ PK g\E ) rdtypes/__pycache__/dsbase.cpython-36.pycnu [ PK g\z\J 1 rdtypes/__pycache__/__init__.cpython-36.opt-1.pycnu [ PK g\z\J + S rdtypes/__pycache__/__init__.cpython-36.pycnu [ PK g\eB rdtypes/dsbase.pynu [ PK g\! rdtypes/txtbase.pynu [ PK g\j_[ rdtypes/__init__.pynu [ PK g\$# # rdtypes/dnskeybase.pynu [ PK g\ @eL L rdtypes/mxbase.pynu [ PK g\ z<# # rdtypes/nsbase.pynu [ PK g\9/ / __init__.pynu [ PK g\ H> s rdatatype.pynu [ PK g\/L L 3 query.pynu [ PK g\k k rrset.pynu [ PK g\D|Z Z " zone.pynu [ PK g\3 4 rcode.pynu [ PK g\$- $- A rdataset.pynu [ PK g\ĵK K jn e164.pynu [ PK g\D9 9 z dnssec.pynu [ PK g\4Vf version.pynu [ PK g\ 9R resolver.pynu [ PK g\)! ! ԅ _compat.pynu [ PK g\˸ / ipv4.pynu [ PK g\/XO U node.pynu [ PK g\K炕: : 4 rdata.pynu [ PK g\ rdataclass.pynu [ PK i